SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039138 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039138
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 352-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 445-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000232
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000039138
Domain Number - Region: 200-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00794
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039138   Gene: ENSCAFG00000002372   Transcript: ENSCAFT00000045181
Sequence length 562
Comment pep:known_by_projection chromosome:CanFam3.1:1:99645111:99825349:-1 gene:ENSCAFG00000002372 transcript:ENSCAFT00000045181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHLCVMFQEQVTFEDVVVDFTQEEWGQLEPAQRTLYRDVMLETFRLLVSVEHQLSKPDVV
SQLEEEEALWSVERGIPQGCYSVYGHCGLLSSTCRSRMNPEEEPTALAMATGLPAEWLQV
TIIREDRECEGQVKLPEKEQDNLRQLEFNLKEAPIQDKSYESLRLGENGVLSSNLNPFPE
ISRIEYLCAYNSQVINSERNSSLVSQQTGSSGKEPCDSSDCSRTSSQAIPILELTRSQVQ
DKPYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCKECGKAFSQNSSLVQHERIHTGDKPY
KCAECGKSFCHSTHLTVHRRIHTGEKPYECQDCGRAFNQNSSLGRHKRTHTGEKPYTCSV
CGKSFSRTTCLFLHLRTHTEERPYECNHCGKGFRHSSSLAQHQRKHAGEKPYECRQRLIF
EQTPALTKHEWAEALGCDPPLNPDERAHRSDRPFKCNHCGKCFIQSSHLIRHQITHTREE
PQGRNRRRLEQSFGRTSQLGRHQHTHSSESSGGGTKAGQPASQALALFDIHEIMQEKNPV
HVIGVEESSMGASVLFDVRESS
Download sequence
Identical sequences J9P0R5
ENSCAFP00000039138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]