SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039621 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039621
Domain Number 1 Region: 462-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 629-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 32-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 685-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 741-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.14e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 11 Region: 787-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 12 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039621   Gene: ENSCAFG00000030402   Transcript: ENSCAFT00000046525
Sequence length 846
Comment pep:known_by_projection chromosome:CanFam3.1:5:39286392:39323767:1 gene:ENSCAFG00000030402 transcript:ENSCAFT00000046525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMVFTVGPLNPEDSQPEEDFHLQAEEPELVKDSVTFKDVAIDFTLEEWRLMDPSQRNL
HKDVMLENYRNLASLGLAVSKPDMISHLEDGKGPWVVVRELARTPYPELETIPATKNAVS
TEDISENVSQETILDKLTENGLWNSRMGGLWKWNERILRLQNSQENHLNQRIVTHKKIPS
GQRGFRFESIIFPEAGVITEELHSKCQTHDDFPENLDLITDPHLGKKICKDTESSKAIRP
TSELTLGKKYNNREKPYKCSTCEKSFRYRSLLIQHQRTHTKEKPYECSECGKMFSQPSYL
SQHKKIHTGEKPYKCNECGKAFIASSSLMVHQRIHTKEKPYQCNVCGKSFSQCARLNQHQ
RIQTGEKPYKCSECGKAFSDKSKLARHQETHNGEKPYKCNDCGKAFRNKSYLSVHQKTHT
EEKPYKCNECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKAYRSNSSLIVHIRTHTGEKP
YECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINYSCLTVHHRMHTGEKPYKCN
ECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLTVHQRIHTGEKPYKCTDCER
AFTKMVNLKEHQKIHTGVKPYKCYDCEKSFRTKSYLIVHQRTHTGEKPYKCNECERAFTN
TSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTGEKPFKCNDCGKAFSQMVHV
TEHQKIHSGEKPYKCDVCGKAFRRGSYLTVHWRTHTGEKPYTCKECGKGCITLSQLTLHQ
RIHTGERPYKCEECGKAFRTNSDFTVHLRMHTGEKPYKCNECGKAFRSSSSLTVHQRIHQ
RETQLI
Download sequence
Identical sequences J9P245
ENSCAFP00000039621 XP_005620142.1.84170 ENSCAFP00000039621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]