SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039685 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039685
Domain Number 1 Region: 111-594
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-132
Family Pyridoxal-dependent decarboxylase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039685   Gene: ENSCAFG00000012560   Transcript: ENSCAFT00000049584
Sequence length 595
Comment pep:known chromosome:CanFam3.1:36:15351289:15391701:1 gene:ENSCAFG00000012560 transcript:ENSCAFT00000049584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTPSSSATSSNAGADPNTANLRPTTYDTWCGVAHGCTRKLGLKICAFFETANILENK
YLQINAFKHNRDLPPLLSCDVHDPPRILVSTKTAVGSLKARYLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRKVA
PKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Download sequence
Identical sequences J9P2A8
ENSCAFP00000039685 ENSCAFP00000018558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]