SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042177 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042177
Domain Number 1 Region: 109-347
Classification Level Classification E-value
Superfamily L domain-like 3.8e-39
Family Leucine rich effector protein YopM 0.05
Further Details:      
 
Domain Number 2 Region: 653-763
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-25
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042177   Gene: ENSCAFG00000018236   Transcript: ENSCAFT00000046134
Sequence length 773
Comment pep:known_by_projection chromosome:CanFam3.1:X:87865239:87968586:-1 gene:ENSCAFG00000018236 transcript:ENSCAFT00000046134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKNPLHSRHKLRVLSGAILSPRNMAASQGGGVNSGGGGCGGGGSSGGGGAAGGGGGGA
GGGGGGGGGTLVVPIPVPTLFGQPFPNGPQWNPGSLQPQHTVRSLDRALEEAGNSGILSL
SGRKLRDFPGSGYDLTDTTQADLSRNRFTEIPSDVWLFAPLETLNLYHNCIKTIPEAIKN
LQMLTYLNISRNLLSTLPKYLFDLPLKVLVVSNNKLVSIPEEIGKLKDLMELDISCNEIQ
VLPQQMGKLHSLRELNIRRNNLHVLPDELGDLPLVKLDFSCNKVTEIPVCYRKLHHLQVM
ILDNNPLQVPPAQICLKGKVHIFKYLNIQACCRMDKKPDSLDLPSLSKRMPSQPLTDSME
DFYPNKNHGPDSGIGSDNGEKRLSTTEPSDDDTISLHSQVSESNREQTSRNDSHSIGSKP
DSQKDQEVYDFIDPNTEDVAVPEQGDAHIGSYVSLLKGKEKGPEKSQKNEELEDEKRLGK
EQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKNRILNHSTSVPRNKPKQTVECEKSVSADE
VNSPLSPLTWQPLENQKDQIDEQQWPESQPIIWQSEERRRSKQIRKEYFKYKSSRKSSSG
NENDEEYDRTDGFSHGPFGLKPRSAFSRSSRQEYGAADPGFTMRRKMEHLREEREQIRQL
RNNLESRLKVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNV
ENFLDACKKLGVSQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSTA
Download sequence
Identical sequences J9P8U6
XP_003435698.2.84170 ENSCAFP00000026940 ENSCAFP00000042177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]