SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042190 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042190
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000183
Family BSTI 0.067
Further Details:      
 
Domain Number 2 Region: 755-816
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000968
Family ATI-like 0.01
Further Details:      
 
Domain Number 3 Region: 647-709
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000785
Family BSTI 0.091
Further Details:      
 
Domain Number 4 Region: 806-855
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000115
Family Fibronectin type I module 0.039
Further Details:      
 
Domain Number 5 Region: 337-385
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000178
Family VWC domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042190   Gene: ENSCAFG00000032054   Transcript: ENSCAFT00000049369
Sequence length 2211
Comment pep:novel chromosome:CanFam3.1:18:45360028:45373794:-1 gene:ENSCAFG00000032054 transcript:ENSCAFT00000049369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAHTGLNETSFVHPDLQRLQNSSQTAPDRGWCSTWGAGHFSTFDGHVYDFLGTCNYIFAA
TCKDTSPTFSVQLRRGPGGGISRVIVELGVSVVTVQKAVISVKDVGVVGLPYTSNGLQIT
PFGQNVQLVAKQLELELVVMWGPGTHLMVLVEKRHMGKLCGLCGDFNGEQTNEFLSEEGK
FLEPHTYAALQTLDDPDEICTYKAVPNPQVPQAEHAQTCTQLLTLVAPECNVPKEPFMWS
CQVDMAECVLRGQHNCSCATLSEYSRQCSMAGQAVSNWRGPGLCPVGTCPANQVYQECGE
TCVKTCSNPQHTCSSFCTFGCFCPKGTVLDDISRNHTCVPVTQCPCMLNGVVYAPGEVVT
AACQTCQCTTGHWKCTEQPCPQRCSLEGGSFVTTFDARPYRFHGTCTYILLQSPQLPDGA
SLVASYDKSGYSHSETALAAIIYMSREDKIVISQDEVFTHNGNTKWLPYKTRNITVFRQT
STHIQMTTTFGLELVIQLEPVFQAYITIGPQFRGQTRGLCGTFNGDTTDDFMASTGIVEG
TASLFVDSWRTGNCPASLERETDPCSMSQLNKVCAETHCSVLVRNGSVFEKCHAMVNPRP
FYKRCVYQACNYEKTILHVCAALSDYARVCATRGILLRDWRNSVDNCTTPCTGNQTFGYD
TRACGRTCLSLSDHAAECHPSAVPVDGCNCPEGTYLNHKAQCVRKSQCPCLLDSNKFILA
DQSAMVNGVICYCINGRLSCPGRPQMLLATCSAPKTFQSCNESSENTFGAACAPTCQMLA
TGTPCVPTRCEPGCVCAEGLYENANGQCVPPEECPCEFAGASYPPGAELHTDCRTCTCSR
GKWTCWQSARCSSTCALYGEGHVVTFDGQRFMFDGSCGYILTTDGCGANNSRPTFTVLTE
NVVCGKSGVTCSRSIKISLGGLSIVLADRNYTVSGEDPHVHFRVNAGSLNLVLDITISNR
YNLTLVWNKHMTIFIKITRATQDALCGLCGNYNGNMKDDFETRSNYVASSELEFVNSWKD
SPLCGDTSLALDPCSLNTFRRAWAERKCGIINSPTFAACHSQVYHLPYYEACVQDACGCD
TTGDCECLCDAVAAYAKACLDKGVCVDWRTPDFCPIYCDYYNTHTHEDGAYQYNQDANCT
WHYQPCLCPQHPQSLPHTNTEGCYNCSQDEYFDQNTGTCVPCMSPPTTPRPTTGTESPVL
EARAQIPKNNPSQNVTALCCLDPNPTPPHPAEPLPAAQTTQWERAEGSGESPRSISAITP
RATSAPTPMTTLKSTATGPTETQTTMKFTASMFSSAMQSTARSTEHTTAAPRTKEISETS
RGPPTSKQTPYACLQKGETHKRGHQPSTNPEHTIQTILLQCFTEKVPQLLTTTTHPPQVT
RRKQPSQGQNRWSKQEHTNPNKNNLLTQDRGPVGKRHTNKARNTATTEPTGASPKHTSIR
NTPMITETKSMETIRSQETTVTENSQLTTHYLPHTHETTTETSRITNTPLTLHTTHTFHP
TPSPAVPTNTLHTTGSPTGTSFRTTTGFPSPSHAETTLSTHMSATSTSSVTPTSHLVISP
TYEPTPSPHSTARHTGTPSPSPHSPGTGTQPTHTKPPLTRTTVTPTSVSTVKTSTSPRSH
PTSPIHQEASSAHPTTISNHPPRTLTTTSWTRSAATSKPHTPHTSHAASSPAVPTSTVHT
TGTPTGTSFRTVTTTSWTRSAATSKSHTPHTSHATSSPAVPTSTVHSTGPPTGTSFRTTT
AFPSPSSSETTISSHASASTTSSVTSTSHLIISPTHQPTPSPHSTARHTGTPSPSPHSPG
TGTQPTHTKPPLTRTTATPTSVSTVKTSTSRPSHPTSPIHQEVSSVHTSAFPSPSHPGTT
LSMHTSASTTASVTPTSHLVITPTYEPTPSPYSTARHTRTSTSTMSSVSRTSHIFISPTQ
QPMPSPISTATHTGSPTPSPFFSSSSSISHTLTSSSSPSTSITASVSSIVYSSGASIPML
SSRSSPSPHTFLPSTLPTKPLPHVSPSSVSSTIIPPSSTKTTPSTPFSHNLSSHSTTSQS
TSLTTRNPTSGIFSSTMGITSPTTNLTTGPSTISRLPTTVILTTPTSRHGSSTLPNIGSL
STVGPSVSSLVTSPSSSTGVCDVKELEEEVTYRGCTANVTVTRCEGSCPASASFNIYTNQ
VDTHCSCCHPVSSYQKQFVLPCSDPEVLGQQLVLTLQMFSSCACSPQHCGV
Download sequence
Identical sequences J9P8V9
ENSCAFP00000042190 ENSCAFP00000042190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]