SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|DEHA2C10604g from Debaromyces hansenii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|DEHA2C10604g
Domain Number 1 Region: 49-158
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.92e-36
Family Frataxin-like 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|DEHA2C10604g
Sequence length 168
Comment weakly similar to uniprot|Q07540 Saccharomyces cerevisiae YDL120W YFH1 [Debaryomyces hansenii] Complete CDS. DEHA2C10604g
Sequence
MFRQVLKVSHRRVVPSIARTTRLVPVLRRPSPNLCISTRSYAFSTEGEAFDDKVDSLSLG
QYNNISNEYLETLADELEMLSEDYPQIDCELTQGVMTLSVPPNGTYVINKQPPNKQIWLS
SPISGPKRYDLIGGKWITLRDGSALTTLLEEEISVALEGAFHFEGIEN
Download sequence
Identical sequences Q6BUH5
gnl|GLV|DEHA2C10604g 4959.Q6BUH5 XP_458144.1.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]