SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|DEHA2B01584g from Debaromyces hansenii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|DEHA2B01584g
Domain Number 1 Region: 226-482,513-554
Classification Level Classification E-value
Superfamily SPOC domain-like 8.04e-47
Family Ku80 subunit middle domain 0.051
Further Details:      
 
Domain Number 2 Region: 3-223
Classification Level Classification E-value
Superfamily vWA-like 8.9e-31
Family Ku80 subunit N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|DEHA2B01584g
Sequence length 723
Comment weakly similar to uniprot|Q04437 Saccharomyces cerevisiae YMR106c YKU80 [Debaryomyces hansenii] Complete CDS. DEHA2B01584g
Sequence
MASKEVTTFIVDLSPSMANKSNGRNISDLEYGLKYFYDIVTNKILRGRKTDYISVITCHS
NRTENPFSSEDSFKNIEVVSNKIAPTYDDLRKYKELLCPNKTEITEDEGDCFESMLVGIG
LLKDTQKLKFVRNVVVITNAESKIKSFETKVADATRNAINEMNINVVLNGIDFDVDGLKY
PDKSPEKAKNESGWASVFHTYKTSEVYTTAQIVESILHNPPLKKVKPMRAFKGQLRFGSD
HCNQNENSDYAPELDQTCISLNVELYPALKAEKLASGHQYTIDPANGSVDKTKYVKDYFI
KLVSSKDEDGKDDDEEVQKRRYDDDDDDEDKDGDLETVSIDANEWTDGFKYSNYDLLTLD
EDLLNSAKLASDPGMDILGFIKMDDLPYAYLTGESYYLLPEVSCSYKNLVGFNGLCQSLV
DLEGLALIRYVQKPNDEIKVCILIPSKIKVNESFVYAFILVRLPFREDEKIGKFPLLTSI
MTTSGKSFTSNTDSPDENPIKQENDEESSNETNLPNAATNSLMESFILSRDLDTKGKNKD
NESNDSDTFFVENNKVTLSNDSLISFPKLSHFGVSSRLLVSSPAIHKFNLNIKKIIIKSL
EDGNLHEYLNNPNFIRDNLISNENDNSGPSTNLFNLSNVLKINSTTNDEWLTDVNKNSKN
VAKKLIKELDTKYVKQEVEAKKKRKMLNNNNLNDIFMMKNAQGNYGAGEGEYEALPDIND
LLN
Download sequence
Identical sequences gnl|GLV|DEHA2B01584g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]