SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|DEHA2G18942g from Debaromyces hansenii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|DEHA2G18942g
Domain Number 1 Region: 615-728
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000149
Family Myosin rod fragments 0.004
Further Details:      
 
Weak hits

Sequence:  gnl|GLV|DEHA2G18942g
Domain Number - Region: 405-554
Classification Level Classification E-value
Superfamily Tropomyosin 0.00235
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|DEHA2G18942g
Sequence length 905
Comment some similarities with uniprot|Q08581 Saccharomyces cerevisiae YOR195W SLK19 Kinetochore-associated protein required for normal segregation of chromosomes in meiosis and mitosis [Debaryomyces hansenii] Complete CDS. DEHA2G18942g
Sequence
MTSPLRFEADMSMIEGEKLSPIKIPPSRLSTNTTSPDILAKHPHGLSAKQDARRNTVHNE
TPKGLTATPLTKKAEPLYSVNKRIPLTSPRATNQPNLDSLKKSKTKLDARLYELKSSSRH
GSPSNKENMHNSGKSTQASQLSSDVNSSISHKSPFESSPSKIDTPIKQINSSFAKNVKSS
PPKSSPSKADKRSIEDDSVIENSRKIAKVITNANESEVSHHKSDDEHLIQIDQVFNKEDL
VGRFSSGASPAKLHEPTVIDEDSDGDIYNNEVNTSHTMTSKMRGNESTQLSRIIKITDEV
DYVTPQRYTEPVAKSPEINQQHRIKENVINNTESKETISPLKNHMLSVNSDQKENHVSSN
RMEDENSDGFNELEDEPTINFLLSPNSKPVFSLDHIKKVQDDHFKEVANLEEVINNKNQE
ILKFSEELSATNNKFLIYDQKIKELKQDKKKLIANENLLLIQLKHNERELASMTKALRIK
ENTVTQLESRLSKSKSKYESTANELESVIEEGNTLREQIKRLEKSVEDKSISQKEYESQI
KILNDEIKEKDTEISSLTDANIDYNIKVENLLSEKEELLTETGRLGRENNGLEEINSKQQ
ELLEELDKLENLAKDKIMTLENTLDSKTQEIKQVMTEKNELLTKIDNLTEENKNLGRELQ
QYKDDVEELTNKLNNYNNARSDLDDKINRLQEGLNKSNEANESLQNKVSGLLEEIERLNQ
HVSESETQMDLLKSINTEKDEIISGDTKKMGELVQKVNKQKQVIADYEKDYSKALEDIKS
LQSKGENTSLNDEIEDLKKQVSQGQAKTNARIQEVAEQLYFEYSKKHELKVNQVRASFKK
QIDNLHFEKKSQARDIDSLQKKLEIVNMEKNQLLRLIDEYQSGSDHNPKKKLSPKKSGIK
KPLRY
Download sequence
Identical sequences gnl|GLV|DEHA2G18942g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]