SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000453 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000453
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.47e-79
Family Calponin-homology domain, CH-domain 0.000000432
Further Details:      
 
Domain Number 2 Region: 2842-2966
Classification Level Classification E-value
Superfamily EF-hand 2.28e-49
Family EF-hand modules in multidomain proteins 0.00000599
Further Details:      
 
Domain Number 3 Region: 2968-3063
Classification Level Classification E-value
Superfamily EF-hand 8.16e-38
Family EF-hand modules in multidomain proteins 0.0000152
Further Details:      
 
Domain Number 4 Region: 1923-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-28
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 3043-3131
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 311-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 2505-2636
Classification Level Classification E-value
Superfamily Spectrin repeat 3.55e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 494-631
Classification Level Classification E-value
Superfamily Spectrin repeat 9.5e-17
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 963-1120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000111
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 10 Region: 2682-2801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000301
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 11 Region: 2233-2334
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000348
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 12 Region: 1181-1332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000072
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 13 Region: 426-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000838
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 14 Region: 1491-1646
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000002
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 15 Region: 2394-2518
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000009
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 16 Region: 2804-2841
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 17 Region: 743-865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000432
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 18 Region: 1619-1743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000288
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 19 Region: 2084-2179
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000017
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 20 Region: 866-978
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000192
Family Spectrin repeat 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000000453
Domain Number - Region: 1305-1436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00112
Family Spectrin repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000453   Gene: ENSCAFG00000000326   Transcript: ENSCAFT00000000501
Sequence length 3432
Comment pep:known chromosome:CanFam3.1:1:35734510:36215162:1 gene:ENSCAFG00000000326 transcript:ENSCAFT00000000501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEARPDDGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVDLVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQSTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDRVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTLDAIREVETLPRKYKKECEEGEISIQSSAPEEEHECPGAET
PSTVTEVDTDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKEQFTTHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVDSMNRQSRLHDVLM
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDLKSLQKLLEDHKRLQNDLEAEQVKVNSL
THMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEERWSRLQEINILWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSIRRLAILKEDMEMKRQALDQLSEIGQDVGQL
VDNPKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRIRE
QVTTKRSKQELPPPPPPKKRQIPVDIEAKKKFDAVSAELLNCILKSKTAIQAAEIKGYKK
MQETSEMKKKLKGLEKEQTERSPRLDELNQTGQVLLEQMGKEGIPTEEIKNVLEKVFSEW
KDISQHLEDLARKIQLQEDINAYFKQLDDLEKIVKTKEEWVKHTPFLEAPQRPLPSLKDS
CQRELTDLLGLHPKIEMARAYCLALKSRPLAPDFVQQGFESLLGRYQAVRQELEHRQQQL
ENELKSQPGRAYLETLKTLKNTLNDSESKAQTSLNVLNDLTKVEKALQEKKALDEILENQ
RPTLYTLAEETKALEKTVSPDVEKMYKQEFDDVQGKWNKLKVKVSKDLHLLEEITSKLRA
FEADSKVIEKWMDGVKDFMKEQAVQRDAEGLQSQLDQCCGFVNEIETVESSLKDMKEIET
NLRSYPVAGIKTWMQTKLVDYQTQLEKFSKEIAIQKNRLSESQEKAVNLKKDLAEMQEWM
TQAEEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIMLLAAKAPSGGQ
ELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKSTEA
LPEKADAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNNRYEEL
SHLAESKQISLEKQLQVLRETDHMLQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKIQ
AEISAHELTLEELRRNIRSQPPTSPESRNARGGSQMDVLQRKLREVSTKFQLFQKPANFE
QRMLDCKRVLDCVKAELHVLDVKDVDPDIIQNHLDKCMKLYKTLSEVKLEVETVIKTGRH
IVQKQQTDNPKGMDEQLTSLKILYNDLGAQVTEGKQDLERASQLARKMKKDTASLSEWLS
VTETELVQKSTSEGLLGDLDVEISWAKNVLKDLEKRKADLNTITESSAALQNLIEGSEPI
LEERLCVLNAGWSRVRTWTEDWCNTLMNHQNQLEVFDGNVAHISTWLYQAEALLDEIEKK
PASKREEIVKRLISELDDANLQVENVRDQAVVLMNARGGSSRELVEPKLAELNRNFEKVS
QHIRSANLLIGQEPLSYQRLVTTEAFEADVLFSDLEKLESDIENMLKVVEKHLEFSGEDE
KVDEERAQIEEVLQRGEQMLHQPMEDNKKEKIRLQLLLLRTRYNKTKTVPNQQRRTGQLA
PGIRLSPLPTDYLVEISKVLLSMDDAELSLNAPELSTVVYEDFSFQEDSLKNIKEQLDKL
GEQIAVIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRINRMYNDRKSHFDRAVEEWRQ
FHCDLNDLTQWITEAEELLAESFTPDGGLDLEKARMHQQELEEGISSHQPSFAALNRTGE
GIVQKLSPTDGSFLKDKLAGLNQRWNAIFAEVKDRWPRLKGENKQVMEYRRRLGEIMCWL
TEAENAMQKRSAAELEENFQELTDLIQEMDVQAEKLKWLNRTELEMLSDKSLSLHEREKI
SESLRIVNSTWNKICREVPSTLKEHIQEPCSVSQTRIAAHPGVQKVVLVSSASDIPVQSP
RTSEISIPADLDKTITELADWLVLIDQMLKSNIVTVGDIEEINKTVSRMKITKSDLEQRH
PQLDYVFTLAQNLKNKASSSDVRTAITEKLEKVKNQWDSTQHGVELRQQQLEDMIIDSIQ
WDDHKEETEELMRKYEARLYILQQARRDPLIKQISDNQILLQELGPGDGIIMAFDNVLQK
LLEEYGSDDTRNVKETTEYLKTSWINLKQSITDRQCALEAELRAVQASRRDLENFLKWIQ
EAETTVNVLADASQRENALQDTLLARELTQQMQDIQAEIDAHNDIFKSIDGNRQKMVKAL
GNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLTSLEELIKWLNIKDE
ELQNQMPIGGDVPALQLQYDHCKALRRELKEKEYSVLNAIDQARVFLADQPIEAPEEPRR
DLQSKTELTPEERAQKIAKAMRKQSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAM
DDLDVDMKEAEAVRNGWKPVGDLLIDSLQDHIEKTMAFREEIAPINLKVKTVNDLSSQLS
PLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQR
SISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDL
LELNTTNEVFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLL
NVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQ
IPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKDFIDWMRLEPQSMVWLPVLHRVAA
AETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPT
TSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPVTLISMWPEHYDPS
QSPQLFHDDTHSRIEQYATRLAQMERTNGSFVTDSSSTTGSVEDEHALIQQYCQTLGGES
PVSQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKEQHLRRGLPVGSPPD
SVVSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDS
RINGVSPWASPQQSALSYSLDPDPDPQFHQAVAEDLLAPPHDTSTDLTEFMEQINSTFPS
CCPNLPSRPQAM
Download sequence
Identical sequences J9P1H1
ENSCAFP00000039395 ENSCAFP00000000453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]