SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001248 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001248
Domain Number 1 Region: 18-164,209-317
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-33
Family Calponin-homology domain, CH-domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001248   Gene: ENSCAFG00000000876   Transcript: ENSCAFT00000001361
Sequence length 332
Comment pep:novel chromosome:CanFam3.1:10:21525425:21544702:-1 gene:ENSCAFG00000000876 transcript:ENSCAFT00000001361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPESFYNLLQRPKVAGPPAEEELPQGEKKKYLPPTSRGDPKFEELQKVLMEWINAKLLP
EHIVVRSLEEDIFDGLILHHLFLREAVRAQAEVKEMALTAPSQRRKLEVVLEAVNGSLQV
GEQQLKWSVATIFSKDLLATLHLLVALAKRFQPDLPLPTNVQVEVITMESTKSGLKSEKS
VEQLTECSTEKDQPTKDVFDELFKLAPEKVNMVKEAIVNFVNQKLDRLGLSVQNLDNQFA
DGVFLLLLIGQLEGFFLHLKEFYLTPTSPAEMLHNVTLALDLLKDEGLLTYPVNPEDIVN
KDAKSTLRVLYSLFQKHKLKEGTCLLPQRRPK
Download sequence
Identical sequences F6UTP7
ENSCAFP00000001248 ENSCAFP00000001248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]