SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002080 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002080
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000238
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 141-170
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000299
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 109-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000856
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002080   Gene: ENSCAFG00000001442   Transcript: ENSCAFT00000002244
Sequence length 809
Comment pep:novel chromosome:CanFam3.1:10:26717355:26738821:-1 gene:ENSCAFG00000001442 transcript:ENSCAFT00000002244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFDSLSKDNVFENNRLAFKVDEKELGIPALLDRNDMICMSVPDCLSIMTYVSQYYNHFAS
PGQAGVSSPRKAQAPSSPPSEASTPAEPGDRAQGEELSLGSLSEQGTQRTPSSTCAACQQ
HVHLVQRYWAEGKLSHRHCFRCRQCSSTLLPGAYRSGPEEGTFVCAEHCARLGPGGRSGT
RPGPPLQPKQQQLGEEVKDVDGGGPGRTAPAGAEAEGSQASPEARPQITTKPRLPNKPQE
LGGSPAGRPTPAPRRAPESPAPTPPTPRPRSSLQHENLAEQGGSSGLVNGRLHEPPVPKP
RGTPKLSERTPAPRKDPPWITLVQAEPKKKPAPLPPSSSPGPPSRDSRRVENGGTEEVGQ
QSQGPAGLEPKPYNPFEEEEEEEPPAAPSLATGPALVPSVESTPKSLHPWYGITPSSPKT
KKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESSSQTPSGELLEPPAVP
KSSSEPTVHAPGTPGTSASLSANSSLSSSGELVQPGADQIPQAGPGLAPGSRGSPGPQPP
KPCGGAAPTPLLLVGDKSPAPSPGTSSPQLQVKSSCKENPFNRKASPTASPTTKKATKGS
KPARPPAPGHGFPLIKRKVQADQYIPEEDIHGEMDTIERQLDALEHRGVLLEEKLRGGVN
EGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWT
EEDRGREKVLMQELVTLIEQRNAIVNCLDEDRQREEEEDKMLEAMIRRKEFQKEAEPEGR
KKGKFKTMKVLKLLAHKRDTKSKPPGDKS
Download sequence
Identical sequences F1PHR9
ENSCAFP00000002080 ENSCAFP00000002080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]