SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002604 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002604
Domain Number 1 Region: 26-181
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.67e-24
Family Calponin-homology domain, CH-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002604   Gene: ENSCAFG00000001792   Transcript: ENSCAFT00000002810
Sequence length 1273
Comment pep:known chromosome:CanFam3.1:13:38518631:38816859:1 gene:ENSCAFG00000001792 transcript:ENSCAFT00000002810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPAHVLEALQPLQPEPPFEPAFCEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNA
IKPGLVKKINRLPTPIAGLDNIILFLRGCKELGLRESQLFDPSDLQDTSNRVTVKSLDYS
RKLKNVLVTIYWLGKAANSSASYSGTTLNLKEFEGLLAQMRKETDDIESPKRSIRDSGYI
DCWDSERSDSLSPPRHGRDDSFDSLDSFGSRSRQTPSPDVVLRGSSDGRGSDSESDLPHR
KLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYVPAPLRRRKAEREEYRKSWST
ATSPLGGDRPCSYPETIEEEGSEVGSPCDEDPAGQVQPGGKPCGRGSGRPAGRGMEQPPP
GGPTAAPAPQSEDRDAVEVQKRRRLEQAGIRVRPAARRFASHKPSSSGEEAVQDTILRKD
NPSPTHPRGKDSESGDNVARRRPDPEKDDFAVRRARMNQTKPRVPLNQLLYGPYQKREAG
KSDGREEHSKGISEKNRLEDKRYGPRTPVSDDAESSSLLDMRCEEEAAVQPHSRARQEQL
QLINSQLREEDDKWQDDLARWKSRRRSASQDLIKKEEERKKMEKLLAGEDGTSERRKSIK
TYREIVQEKERRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSH
STEPNLTPFLNDPNPMKYLRRQSLPPPKFTATVETTIARTSVLDTGVSAGGGSPSKTVPP
KAVPMLTPKPYSQPKNSQDVLKTFKVDGKVSMNGEAVHGDKEKERECPTVAPAPSLTKPQ
MFEAVARVHGSPVELKQDNNSIEINIKKPSSVPQELRATTEETEPNSQEDENDGGKTQKG
NTELAPSEPQHFTTTVTRSSPTVPFVEFPSSPQRRNDVPPEEDQKKLGNEMSGKVELVLS
QKVVKPKSPEPEATLTYPFLEKMSETNQLHLPNLNSQVDSPGSEKSPVTTPFKFWAWDPE
EERRRQEKWQQEQERLLQERYQKEQNKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVP
FTLSSSSADQLSTSSSVTEGTGTVSKMDLENCREEEQETKQKKPLRGDDSDLMPKTREDH
PLEGKGSLTQGALAPSKNPGSKGVHQDHQLDAETGALRCGMNSQLAQDPPQNTQVSNPPM
HVLEDVKPKTLPLDKSINHQIESPSERRKKSPRENFQAGHLSPCSPTPPGQSPNRSISGK
KLCSSCGLPLGKGAAMIIETLQLYFHIQCFRCGLCKGQLGDAVSGTDVRIRSGLLNCNDC
YLRSRSAGQPTTL
Download sequence
Identical sequences F1PHJ6
ENSCAFP00000002604 ENSCAFP00000002604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]