SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000003533 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000003533
Domain Number 1 Region: 155-441
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.02e-85
Family Calponin-homology domain, CH-domain 0.00000106
Further Details:      
 
Domain Number 2 Region: 1736-1931
Classification Level Classification E-value
Superfamily Plakin repeat 2.22e-45
Family Plakin repeat 0.00022
Further Details:      
 
Domain Number 3 Region: 1936-2118
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-39
Family Plakin repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 6727-6885
Classification Level Classification E-value
Superfamily Spectrin repeat 5.83e-30
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 6557-6670
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 457-573
Classification Level Classification E-value
Superfamily Spectrin repeat 1.25e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 6967-7102
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-25
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 6399-6558
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-25
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 9 Region: 6068-6227
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-24
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 5526-5682
Classification Level Classification E-value
Superfamily Spectrin repeat 5.17e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 11 Region: 7098-7213
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-21
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 12 Region: 7460-7542
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.7e-20
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 13 Region: 6888-6997
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-19
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 14 Region: 5089-5243
Classification Level Classification E-value
Superfamily Spectrin repeat 3.19e-19
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 7163-7290,7320-7351
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 16 Region: 4307-4447
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 17 Region: 5961-6108
Classification Level Classification E-value
Superfamily Spectrin repeat 1.84e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 18 Region: 4756-4883
Classification Level Classification E-value
Superfamily Spectrin repeat 2.73e-18
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 19 Region: 5302-5462
Classification Level Classification E-value
Superfamily Spectrin repeat 2.65e-17
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 20 Region: 5678-5794
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 21 Region: 892-994
Classification Level Classification E-value
Superfamily Spectrin repeat 9.5e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 1427-1555,1582-1610
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 23 Region: 7371-7451
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000108
Family Polcalcin 0.044
Further Details:      
 
Domain Number 24 Region: 4977-5099
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000078
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 25 Region: 4065-4173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000936
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 26 Region: 6225-6338
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000907
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 27 Region: 4225-4338
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000314
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 28 Region: 5790-5903
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000615
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 29 Region: 4505-4625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000267
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 30 Region: 4664-4773
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000035
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 31 Region: 799-891
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000484
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 32 Region: 4888-4990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000136
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number 33 Region: 984-1074,1195-1215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000864
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 3568-3675
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000504
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000003533
Domain Number - Region: 3691-3809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000115
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 3819-3932
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00216
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 1221-1362
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0262
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 4016-4073
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0863
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000003533   Gene: ENSCAFG00000002413   Transcript: ENSCAFT00000003820
Sequence length 7767
Comment pep:novel chromosome:CanFam3.1:12:23716638:23882208:-1 gene:ENSCAFG00000002413 transcript:ENSCAFT00000003820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATIVFFCCWHRRLQKGRHPMKSVFSGRSRSR
DAVMRSHHFRSEGFRASPRHLRRRAAAAAAARLEEAKPVVEVHHQSEQEISVRKRRIKKN
SRVQPEFYHSIQGASTRRPSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWN
LPKHERSKRKIHGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYED
LRDGHNLISLLEVLSGDTLPRERDFLKTLRLPREKGRMRFHRLQNVQIALDYLKRRQVKL
VNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAG
IRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDP
EDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHH
VTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLL
QGYHPNDIEKEWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILARNA
LQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLR
DEIMALRNECSSVYSKGRMLTTEQTKLMISGITQSLNSGFAQTLNPSLNTGLTQGLTPSL
TPSSVTSGLSSGLTSRLTPSVTPAYTPGFPSGGLVPSFSSGVETNSLQTLKLMQIRKPLL
KSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIE
EFESSLKEAKISEIQMTAPLKLTYTEKLHRLENQYAKLLNTSRNQERHLDTLHNFVTRAT
NELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLEN
HPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQ
RKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIASLMGRAKTIIQLKPRNPDCTLKTS
IPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAV
DFANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVL
SNLQSRFEDFLEDSQESQIFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYI
SEVRNIRLRLESCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNK
CEEFFSQAATSASVPTLRSELGVVIQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVK
LYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKREVFHALEDELQKAKAISDEMFKT
YKERDLDFDWHKEKADQLVERWQNIHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQV
ETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSTTVKDYELQT
MTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLE
EEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDGEKAGKSPFSKQKISSEEISTKKEQLS
ETLQTMQLFLAKHGDKMTDEERNELEKQVKSLQESYNTFFSESLKQLQESQSLGDKKVEE
KLDKVIAGTIDQTTGEVLSIFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLQD
AKSRGLIDEQVVCQLQELNQAKEIISTVSSTTIPVLEALAQGMISESMAIRVLDILLSTD
FLVIPATGEKLTLQKAFQQNFVSSALFSKVLERQNTCKDLIDPCTAEKVTLVDILQRSIL
QENTGIRLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLGAQLLSGGLINCN
SGRRMTVEEAMAEGVIDRDTANSILTYQVQTGGIIHSNPAKRFTVDEAVQCDLITSTSAL
LVLEAQRSYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPETSQVIG
LDVAKQLGIIDNNTASILKSIILPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQED
DVFDGEEPLATQSSEQTKKLFLSYLMINSYMDANTGQRLLLYDGDLNEAVDMLLEGCSAE
FKDTPIKKCLDALRLPVLFPSNTPNEGKENSMVSPNSFDKCHHREPKQKEAPEDRKHTID
KECNEMGNNFFSSEFYQSENLANIKVADNKVQNSSYLSQPGLVAGDMLRQDSENILKNCE
NQSQVRTNEHAGECSHSKNIQNFASDLITNSIMKSKTSRICDLNENEKENEDNINRDLTI
FDYSPRLSALLSHDKLRNDQDSLNVHTTESNGNKCEDPTLPLSDQTILSGQRMGETFQEQ
FLGIAAINISLQGVTSPQKPLNIGDIAPQVQNHNDKYITETYGEDGKLHATSQQKSENKQ
TESKMEEYPCAVTPQDNTSDAGTSPVCATPLLEETISAGDYETSLVDDQRSVTETDTDSE
GDFYDTPLFEDDDHDSLLLEGDDRDCLQPEDYATLQEETDVTASLGDVFYDVSRENENSV
ELQGALVDSLSVRGNRESLRDVLIATEKAGFDSDERIHSDSVGSHKSNGQFLETISERES
SNILESDESDSSIDYKIIERKESFSALLTFDDIGYWGGREEEHITGQEFKSDTEHLDSMQ
SEESYKDYVCDSNDQDIDDDYYYDDGGGDDEGGVEGDGKEPWCQDEAADMDIQLCATAVS
EKENGQDSQSVKRILPDKVHSYRSLENQQNVNVLQPKSTGKYSLVTERSNLQEYTTEVVG
KSQDLLNHELALKDILLPITKDTESEDSFGSVDILHNTNNICSTSEVDNDLMNIKLIQGP
ESTDSLKGRDPYFENVTLQVHSSFDKIICSEPDLIGKPAEESHLSSVASVTVGDHQGNER
GLIKKKGDQISILTEDETSVHKMCSGKGKVLEKGQEEDNKHLRLLPSESTRESLDLDNDQ
FPFSRITDNEEHNQKGSLKKVTVTLKDEPKNLQTVVSESPVHFENLEEIFDSSVSKVISA
DMILLSEGDTSTEKDSFTDSPEKDSDLFTYLKHCSKDVKAKDALKLNEGIPSCILIASPA
VKEHVQFGVNDTKEKTAPTQEVSPLNEMAQQNDIHTKESALEAGTGVADLTPERDESTLS
ILPLRNVEDLGENNDFVPPELCTNGIKNDNSSNPLNMDYSFSEINNKMEIIEQQQQKEQS
LSLGFQEKEVQIPEVSQVFFENVKDFLKRRLEGGPMSPEEVGESLVCADTKILIQNLIKR
VTTSQLANEASSVPSDFKIGDCSGVYPMNNSTELKAESRDDPFHIAHLKSELLLDILKQN
QYSQKITGAFELMKELTQMEYELEKRGLTPKVSPVQLENIFYKLLADTYSEKVEQVRDLN
QKAFSTSEMVDENSHILDDLKSKEGNHCSLNLQNIKDTELENSTVCASALPSNEKLGELC
CDIPDHLESISGSKGMTPGDRSMEQFSTELQQCLQHTSKMHEYLALLQEMKPPLDNQESL
DNNLEALRNQLKQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGQLEELRTSHQS
LQTAFTSLSSVSSERMKHVMLTMDSEMSKLAVSHEEFLQKLESFSHWISEKSKSVKDIEI
VNVQDTEHMKKSLEFLKNVLKDLGHTKVQLEATALDVQFFISECAQDLSPNQSKQLLRLL
NTTQKCFLDVQESVTARVECLETQLQLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTEN
RLIGHQEAFVIGDGTVELKKYQSKQEELQKDMQGSAQALAEIVKNTENFLKENGEKLSRE
DKALIEQKLNEAKLKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAAKQLEESKTKIEN
LLDWLSSIDKDSDRAGMKQRQAIEQNGTHFPEGDGMSAMGEEDDVNGNLLETDVDGPVGP
TEDNLNQQYQKVKAQHEKIVSQHQAVLMATQSAQTLLDKQGHYLSPEEKEKLQKNMKELK
EHYETALATAEKKMKLTHSLQEELEKFDADYSEFQHWLQQSEQELENLEAGADDLSGLMT
KLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSRRSGGSKAAQDHIDTSATYREVQ
GKLDHASDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCALLSGLQACEVTASKHLSEPI
AVDPKNLQRQLEETKALQGQISNQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIV
GRYDDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGSVESSLKEQGQVPLNSAALQD
VISKNIMLEQDITGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSVRFSEASRKHK
EKLAKMEELKTKVELFENLSEKLQTFLETKTQALTETDVPGKDVTELSQYMQESTSEFLE
HKKDLEVLHSLLKEISSHGLPGDKALVFEKTNNLSKKFKEMETTIKEKKEAVSSCQEQMD
AFQVLVKSLKSWIKETTERVPIVQPSFGAEDLGKSLEKTKKLQEKWSLKTPEIQKVNNSG
ISLCNLISAVTTPAKAIAAVKSGGVILNGEGTATDTQEILANKGLTSIKKDMTDISHGYE
DLGLLLKDKIAELNTKLSKLQKAQEESSSMMQWLQKMNKTAAKWHQAPTPTDTEAVKTQV
EQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPKWKQMLTEIDSKWQELNQLTVD
RQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEF
DTRKTQYEQLTAAGQGILSKPGEHPSFHGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAI
VKSTQYQSLLRSLSDKLSDLDNKVSISVAVSTHPDAMNQQLEAAQKLKQELEQEMKQIKV
AQALCEDLSALVKEDYLKAELSRQLEGILKSFKDIEQKAENHVQHLQSACASSHQFQQMS
RDFQVWLDTKKEEQNSSPPISAKLDVLESLLKDQKDFSKMLSAQSSIYEKTIAEGENLLL
KTQGSEKAALQSQLNTIKTSWDGFNKQVKEREDKVKDSLEKALKYKEHVETLRPWIDKCQ
NNLEEIKFCLDPTETENSTARLKSLQKEMNQHLGMVELLNNAANSLLSVCEVDKEVITDE
NKSLIQKIDMVTEQLHSKKFSLENMAQKFKEFQEVSKEAKRQLQCAKEQLDVHDSLGPQA
YSNKYLSVLQTQQKGLQTLKHQVDLVKGLAQDLVVEASDSKGTSDVLLQSESLVQEHSAL
SQQVDERCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDVETLQKQKEAIK
AFLKKLEALIASNDNANKTCKMMLAMEETSPDLIGIKRDLEALSKQCNKLLDRAQAREEQ
VEGTIERLEEFYSKLKEFSTLLQKAEEHEESQGPVGMETETINQQLNVFKAFQKEEIEPL
QVKQQDVNWLGQGLIQSAAKGTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCG
RFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKRE
GEKIAATAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNE
WLTTIEKKLANCEPIGTQASKLEEQITQHKALEDDIIHHNKHLHQAVSIGQSLKVLSSRE
DKDMVQNKLDSSQVWYIEMQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSK
LSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEA
IKARYKDITKLSTDVAKTLEQALQLARRLHATREELCTWLDKVEVELLSYETQVLTGEAA
SQAQARQKELKKEAKNSKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNDRYRLVSDT
ITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQLQKTFT
MEILRHKDIIDELVKSGHKIMATCSEEEKQSMKKKLDKVLKNYDAICQINSERYLQLERA
QSLVNQFWETYEELWPWLTEIQRVISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHID
KMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKID
QILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKKRGEEMIAR
SEGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTTK
DTQDFIRDLEDPGIDPSVVKQQQEAAEAIKEEIDGLQEELDMVINLGSELIAACGEPDKP
IVKKSIDELNSAWESLNKAWKDRVDKLEEAMQAAVQYQDGLQAIFDWVDIAGGKLASMSP
IGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELK
LIWDSLDERIINRQHKLEGALLALGQFQHALDELLTWLTHTEGLLSEQKPVGGDPKAIEI
ELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTE
QRKQQLDGALRQAKGFHGEIEDLHQWLTDTERHLLASKPLGGLPETAREQLNAHMEICAA
FDVKEEIYKSLMQKGQQMLARCPKSAETIDQDLNNLKEKWESVETKLNERKTKLEEALNL
AMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELD
KTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKL
MEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTS
LADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQ
LAEDQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQM
QELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGALPDDED
ALRTLIDQHKEFMKKLEEKRAALNKATSMGDAVLAICHPDSITTIKHWITIIRARFEEVL
AWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLSDKDKEVIPQEIEEVKALIAEH
QTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQT
QIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMN
HKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYY
EFVAALHPNKDAYKPVTDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDS
QQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILADGASQGMAA
FRPRGRRSRPSSRGASPNRSTSVSSQAGQAASPQVPATSTPKILHPLTRNYGKPWLTNSK
MSTPCKPAECSDFSVPSAEGTPIQGSKLRLPGYLSGKGFHSGDDSGLITTAAARVRTQFA
DPKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPPTHRPTPRAGSR
PSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences J9P0W8
ENSCAFP00000003533 ENSCAFP00000039191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]