SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004040 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004040
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2191-2310
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-38
Family Pleckstrin-homology domain (PH domain) 0.00000198
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 603-742
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-31
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 1011-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 6.89e-29
Family Spectrin repeat 0.0000223
Further Details:      
 
Domain Number 6 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-28
Family Spectrin repeat 0.00044
Further Details:      
 
Domain Number 7 Region: 1859-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 2.61e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 811-951
Classification Level Classification E-value
Superfamily Spectrin repeat 4.94e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 1487-1598
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-24
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 10 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-24
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 1699-1804
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 1595-1696
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-22
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 13 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 14 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 15 Region: 1994-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000017
Family Spectrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000004040
Domain Number - Region: 1170-1242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004040   Gene: ENSCAFG00000002744   Transcript: ENSCAFT00000004367
Sequence length 2364
Comment pep:known chromosome:CanFam3.1:10:55429989:55571916:1 gene:ENSCAFG00000002744 transcript:ENSCAFT00000004367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIL
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEIANYRPTIDTLHEQASALPQEHAESQDVRGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQSLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
REAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHNMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLNA
EAIRRRLADLKELWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEK
AKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERF
REFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQV
RQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMV
RDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLAR
KHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYL
SSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPEPSTKASEDTESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTGEMVNGAAEQRTS
SKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSR
SWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLN
DGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSES
SPGKREKDKEKDKEKRFSIFGKKK
Download sequence
Identical sequences F1PXU1
ENSCAFP00000004040 ENSCAFP00000004040 XP_531827.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]