SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004624 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004624
Domain Number 1 Region: 442-547
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-29
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004624   Gene: ENSCAFG00000003106   Transcript: ENSCAFT00000004987
Sequence length 1231
Comment pep:novel chromosome:CanFam3.1:10:62512881:62825407:1 gene:ENSCAFG00000003106 transcript:ENSCAFT00000004987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQP
GIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIENESPSGRRKALATSSIN
MKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEEDDENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKQANMPSAK
SASSSEELINKLNFLDEAEKDLATVNLNPFGDPDVAELNPFGDPDSEEPITETASPKKSE
ESFYNNSYNPFKEIQTPQYLNPFDEPETFVTIKDSPPQSTKRKNVRPVDMSKYLYADSSK
TEEEELDESNPFYEPKPTLPPNNLVNPIQELETERRVKRKAPAPPAISPKTGVNENTIIS
AGRDLSTSPKPSPIPSPVLGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCA
ILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYL
YQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDLKREPELQQP
TSGAVDFLSQDDSVFVNDSGVGESESEHQTPDDHLSPSTASPYCRRTKSDTEPQKSQQSS
GRTSGSDDPGIYYNTDSTHAQVLLGKKRLLKAETLELSDFYVSDKKKDVSPPFIYEETEE
QKLQTLDISKNLEKEKLENSRPLECRSDPESPIKKPSLSPTSKLGYSYNRDADLTKKKRT
SLRQTESDPDTDRTTLNHADHSTKTVQHRMLSRQEELKERARVLLEQARRDAALKAGNKQ
NPNAATPLCNRQLSDQQDEERRRQLRERARQLIAEARSGVKMSELPSYGEMAAEKLKERS
KASGDENDNIEIDTNEEIPEGFVVGGGDELTNLENDLDTPEQNTKLVDLKLKKLLEAQPQ
VANSLSSAAQKAITESSEQDIKNGTEDLRTERLQKATERFRNPVVFSKDSTVRKTQLQSF
SQYVENRPEMKRQRSIQEDTKKGNEEKAAITETQRKPSEDEVLNKGFKDTSQYVVGELAA
LENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKNALIRRMNQLSLLE
KEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVALVNKRDALVRDLDAQE
KQAEEEDEHLERTLEQNKGKMAKKEEKCVLQ
Download sequence
Identical sequences F1Q1V9
XP_005626202.1.84170 XP_005626203.1.84170 XP_013973034.1.84170 XP_538507.2.84170 ENSCAFP00000004624 ENSCAFP00000004624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]