SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004683 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004683
Domain Number 1 Region: 9-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-85
Family Calponin-homology domain, CH-domain 0.00000127
Further Details:      
 
Domain Number 2 Region: 1455-1679
Classification Level Classification E-value
Superfamily Plakin repeat 2.22e-53
Family Plakin repeat 0.00011
Further Details:      
 
Domain Number 3 Region: 1683-1861
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-47
Family Plakin repeat 0.0004
Further Details:      
 
Domain Number 4 Region: 2417-2602
Classification Level Classification E-value
Superfamily Plakin repeat 1.66e-43
Family Plakin repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 6214-6371
Classification Level Classification E-value
Superfamily Spectrin repeat 6.52e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 2233-2397
Classification Level Classification E-value
Superfamily Plakin repeat 1.23e-30
Family Plakin repeat 0.00075
Further Details:      
 
Domain Number 7 Region: 6650-6808
Classification Level Classification E-value
Superfamily Spectrin repeat 6.65e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 5224-5384
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-28
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 9 Region: 2604-2709
Classification Level Classification E-value
Superfamily Plakin repeat 2.22e-24
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 5335-5481
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-23
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 254-370
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-23
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 12 Region: 4789-4946
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-23
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 6803-6920
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-22
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 6453-6591
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 5771-5928
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-21
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 16 Region: 7163-7245
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.37e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 17 Region: 6869-6996,7023-7054
Classification Level Classification E-value
Superfamily Spectrin repeat 1.95e-20
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 18 Region: 6012-6153
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-19
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 19 Region: 5553-5707
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 5003-5163
Classification Level Classification E-value
Superfamily Spectrin repeat 4.22e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 21 Region: 3930-4045
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-16
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 22 Region: 4501-4620
Classification Level Classification E-value
Superfamily Spectrin repeat 7.32e-16
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 23 Region: 6369-6485
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000103
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 24 Region: 7074-7154
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000131
Family Polcalcin 0.057
Further Details:      
 
Domain Number 25 Region: 4679-4800
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000364
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 26 Region: 1171-1297,1324-1350
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000402
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 27 Region: 3765-3889
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000171
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 28 Region: 4394-4509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000262
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 29 Region: 4009-4150
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000576
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 30 Region: 4227-4329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000811
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 31 Region: 626-728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000236
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 32 Region: 3552-3669
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000222
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 33 Region: 5933-6039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000273
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 34 Region: 535-625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 35 Region: 694-811
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000245
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 36 Region: 3385-3538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000763
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 37 Region: 1368-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000921
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000004683
Domain Number - Region: 4157-4263
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000158
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number - Region: 5138-5216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.024
Further Details:      
 
Domain Number - Region: 874-945,1043-1100
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0576
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004683   Gene: ENSCAFG00000003120   Transcript: ENSCAFT00000005050
Sequence length 7437
Comment pep:known chromosome:CanFam3.1:15:3363106:3573248:-1 gene:ENSCAFG00000003120 transcript:ENSCAFT00000005050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAYKYQKFLEGLNNLRDERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLL
EVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTI
ILHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRY
RPDLVDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDA
FPKVPEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTLLMSDKSFPQNPVELKALYNQY
IHFKETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLERE
KSLRPAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMY
IQECEGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLE
LAPPSTLTTTHLKAEPLTKGTHSSSTSWFRKPMTRAELVSISSSEDEGNLRFVYELLSWV
EEMQMKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYVE
TLGKLETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNIS
AKRNYFSELTMQLEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAAQSQLQWMKQLCL
CVEQHVKENTAYFQFFSDARDLESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKE
QLIQSKSSVASLVGRSKTIVQLKPRSPDHVLKSTISVKAICDYRQIEITICKNDECVLED
NSQRTKWKVISPTGNEAMVPSVCFLIPSPNKDAIEMASRVEQSYQKVMALWHQLHVNTKS
LISWNYLRRDLDLVKTWNLEKLRSSGPGECHQVMKNLQAHYEDFLQDSRDSLLFSVADRL
RLEEEVEACKTHFQHLMKSIENEDKEETVAKMYISELKNIRLRLEECEQRLVKRIQSPAS
SRTDKDARQDNALRIAEQERTQEDLQQLRSEFDAISMKCNSFLHQSPSGSSVPTLRSELN
LLVEKMDHVYGLSTVYLNKLKTIDVIVRSIQDAELLVKGYEIKLSQEEAVPADLSALESH
RSTLRHWLSDVKDKNSVFSVLDEEIAKAKVVAEQLSRLTPERNLDLERYQEKGSQLQERW
HRVIVQLETRQSELESIQEVLGDYRACHGTLIRWIEETTAQQEMMKPGQAEDSRVLSEQL
SQQTDLFAEIEKNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLS
SSDAITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLG
WVSTLARNTQSKATSSQTKESADIEKAILDQQVLAEELTTKREQVSEAIKTSQIFLAKHG
HKLSEKEKEQISEQLNALNKTYHDLCDGSANQLQQLQSQLAQQTEQKGCRAIAGVIDLGT
VEIFPIFKAMQKGLIDQDTGLVLLESQVIMSGLIAPETSEKLSLEEGLARNLINPPMYQQ
FQELQDVLSLISRLTESKGLLSVVEAIEKKIISERVGLKVLEAHLAAGGFHLSPNKSCIN
LEEAFHQGLISARLHSVLESSLKSSKNLIDPNTAEKVSLLDLMQRCIVHQDSGLKLLPVK
QLAGGMVSLKSGRKVSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVEEAVR
HNLIDQDMACALLIRQLQTGGIIDTVTGHRLTIDEAVNNDLVAAKIALVILESLWSFMGL
LWPESGEILPITDGLEQGLVSTELAHKILSGRQHIKALFLPASTEVWSWKKVVEDGMLDK
DLVDNLRSVCIPDVMPHMQLADSSERSKLNINPGAGGLPRSQSQTEGMVSPSEKLLFQLM
THSYINVRDGQRLLLLDNKLIETLTARDEHQAGPPEMFEVGHQRLETPEGLQESINVKTT
ETFCDGLSRQPREFQASFQNEEYPNQADCAEAKGKTTTVEIEASPIENFQRDLFVGEQKV
RNPNVGTLMVLDKGKSELKRQLLDTKKEELIGMSTRENVSRRFLHIVPTEEAEDVTLAAG
RDPFSVEKLNEEWQTPGKTSFLCRTEQANTLDIEIPGESERPLLKPQSKKSQFQRKKMLN
LESKLESENNMNIPTLDKKKNLSKTFSGRDDHKQNPEGHDIVGGSMMTLEKTDAEDNDHE
PSLLCSHPSEMLQEATLNTLSAQLLDSGIIHENTGQKLLLNEAIARGIVPSHTAVKLMGK
LNMFRGFFDSQTCESLTTEEVIDEGLMDEKLLHNVLMAEKAISGVLDPRTRTLCSVKEAV
AFGLLDTQTASRILEGQVVTGGIVDLKRGKKVSVTLASNLGLVDCADQTELINLEKASKG
RDAEKAVRERFISLQMETTGIMDPESKAPLTIMQSIDRGLLEREEAIRLLTKQVVDGGII
HHISGMRLSVDNAFEHGIIDEDLAKQLKKAENLSVCQFFHPETKETLSLLEAIKLDLVTP
DLKREIQEIQALTGSFVDLISSQRLTLAEAEKEGLLSNKAILSSGMVHGIVDPENCRIVP
YSELVKKCKIDIESGQRYLEVIPFSGIKDEASDKVLTLSQATQLGKVDFLSTLKVLEAQA
NTGGIIDTATGKRLTLASALEKELVDENMVRIIASRQVVNGGIVDIFNDQRVTLKEAVEK
RLISPELATMIQIDTLESCDHRAQIEKQDGIEVCEIEKEFLRKEMLIDCNQTAGMNNGKG
ASEKLFQIGSQSAQGKVKARVSDRGQAKKSRDISLKELECKAQDKRRASPDAEESVSIIV
PGHHKGTPLGQGLVTHSHSEVCNFKLKEVASDDMEKNTNEEQENMGAHREITSLMKHSIS
GPVPKEIVENQERIISEVQESDYETSGKLPSEQKPMNTSEKSKRGKRKMIIEESVKTCKP
ILSEEKLNQETTIRADQGSNVESPPVEITINEKGEEAGRKLGFSIICKTQNSSPVIPKGI
SVNQDALTFSKSYQVSEGEAKNLSLSLILKQEENLSQITGGAQSEPSSSTIPRPEGLHYQ
ESVRKAQVAGRSQISETNKPFQGTIRLETNSFQDSCVTFKTKETKDLICSSDGCKERSYQ
ELPFDSTRTLKLEETTVSTVDPKEINYLEFSDRKDFHHQDNRSDGEICGVLASNIVTTQE
MTGEKFLERSNSTVTGVEAASFEGIAQGVPRVLVSLLPEKLFKDVSQKESSGQQDATISP
TIPETSEEKPIPHVHPTLKMAEKTPLEKLRESPGGEQTPFTTTAGGRGNEGVNLEPSRTT
KNVFNRQLCLEHDEKLVSYLSLLRDIEMRTKQIQPLDRNVAELQDLLCQAKVLDRELKDL
STLVNQELECVNQIIISQPQEVPAQLLKALEKDAKNLQKSLSSVSDTWSSRLLHLQSAME
VKKTKVLSQHEQLEGRLQDLRIWVGDTNLLLNSKEYNDETDTDSLRHCLQQYEDLKQPMA
ERKSQLDALAFDIQFFISEHAQDMSPQQNRQMLRLLNELQGSFQDLVEQTAARMDALQGH
FQQMEQAAWVKTLQKQQNTCHQKLEDLCNWLGQAESTLAGHQDRATQQDLSTLQKHQSDL
KDLQDDIQNRAASFASVVKDIEGFLEENRAKLSPHELTALQERLHQAKEQYEALQERTRV
AQKELEEVVTSAVQQETAKSKAAKELAENRSKIDVLLDWVTAVESSGGQMEQLSGADLRK
RAFDTTDGHQGASQAPKELDQQCEKMKARHQELLSQQQNFILATQSAQAFLDQHGHNLTP
EERQVLQDKLGELKGQYAASLARSEAELKQVQTLRDELQKFLQDHQEFENWLERSERELE
NMHRGVSSPETLPSLLKRQGSFSEDVISHKGDLRFVTISGQKVLDTENSFEEGREPSATG
NLVKGKLKDATERYTALHSKCTRLGSHLNMLLGQYQQFQSSADSLQTWMQACEANVEKLL
SDTIASDPGVLQQQLATTKQLQEELAEHQVPVEKLQKVAHDLMEIEGEPAPDRKHVQETT
DSILRHFQSLSSSLAERSALLQKAIAQSQSVQESLDSLLQSIGEVEQNLEEEQVASLSLG
VIQEALATNMKLKQDIARQKSSLEATREMVTRFMETADSSTAAVLQGKLAEVSQRFEQLC
LQQQEKESSLKKLLPQAEMFEHLSDKLQQFMENKSRMLASGNQPDQDIAHFFQQIQELNS
EMEDQQENLETLENLVTELGSCGFALDLSQHQDRVQNLRKDFTELQKTVKEREEDASSCQ
EQLDEFRKLVRTFQKWLKETEGNLPPTETFMSTKELEKQIEHLKGLLDDWASKGSLVEEI
NCKGTSLENLIMEITAPDSQAKTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKY
EKLGGVLQERQESLQAVLSRMQEVQKEAGSVLQWLESKEEVLKAMDASSSPTKPETVRAQ
AESNKAFLAELEQNSPKIQKVKEALAGLLMTYPNSQEAESWKEMQEELNSRWERATEVTM
ARQRQLEESASHLASFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLTAQKQQVQFMLKE
FEARRQQHEQLNEAAQGILTGPGDVSPSTSQVQKELQSINQKWIELTDKLNSRSSQIDQA
IVKSTQYQELLQDLSEKVKAVGQRLSGQSAISTQPEAVKQQLEETSEIRSDVEQLDHEIQ
EAQTLCDELSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQM
FDELRTWLDDKQSQQAKNYPISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLL
LTVPPGEEKKTLQNQLVELKSHWEELSKKTADRQSRLKDCMQKAQKYQWHVQDLVPWIED
CKAKMSDLQVTLDPVQLESSLLRSKAMLSEVEKRRSLLEILNGAADILINSSETDEDDIR
DEKAGINQNMDSITEELQAKTGSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIFDALGS
QACSNKNLEKLRAQQEVLQTLEPQVDYLRNFTQGLVEDAPDGSDASQLLRQAEVTQQEFL
EVKQRVNSGCMTMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIED
VRLFLNKIQALRLDIEASEAECRQMLEEEGTLDLLGLKRELEALNKQCGKLTERSRARQE
QLELTLGRVEDFYRKLKALNDMTTAAEEGEALQWVVGTEVDLINQQLADFKMFQKEQVDP
LQMKLQQVNGLGQGLIQSAGKNCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHC
GKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQA
EGGRIAQSAELADREKITGQLEGLESRWTGLLSKAAARQKQLEDILVLAKQFHETAEPIS
DFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALEEEIESHATDVHQAVKIGQSLSSLTCS
AEQGVLSEKLDSLQARYSEIQDRGTRKAALLEQALSNARLFGEDEVEVLNWLAEVEDKLS
SVFVKDYRQDVLQKQHADHLALNEEIINRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLD
GIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLREVEEELAASGGQSPTGEQ
IPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSD
TVGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAF
SIDIIRHKDSMDELFSHRGEIFGTCGEEQKAVLQEKTESLIQQYEAISLLNSERYTRLER
AQVLVNQFWETYEELSPWIEETRALIAQLPPPAIDHEQLRQQQEEMRQLRESIAEHKPHI
DKLLKIGPQLKELNPEEGEMVEEKYQKAENLYAQIKEEVRQRALALDEAVSQSAQIAEFH
DKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSAAVELEKLQPAFEALKRRGEE
LIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALL
TTVRDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGE
TEKPEVKKSIDELNNAWESLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLC
TMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKAMDETDRDIIREPL
TELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPVSGDPK
VIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLETMNQCWESVL
QKTEEREQQLQLTLQQAQGFHSEIEDFLLELTRMETQLSASKPTGGLPETAREQLDTHME
LYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKL
EEALNLATEFQNSLQEFINWLTLAEQNLNIASPPSLILNTVLSQIEEHKVFANEVNAHRD
QIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFH
EAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRA
LKEKTLLPDDTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWL
YKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTT
WVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGA
LPDDTEALQSLIDTHKEFMKKVEEKRADVSTAVAMGEAILAVCHPDCITTIKHWITIIRA
RFEEVLTWAQQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVK
ALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPAHTPFIEKSRSGSRKSLSQPTPPPMP
ILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMR
WMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYI
DYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQF
GDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQG
MTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSTGSKLKR
PTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSD
ASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences J9PAW7
ENSCAFP00000042945 ENSCAFP00000004683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]