SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005642 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005642
Domain Number 1 Region: 24-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-47
Family Calponin-homology domain, CH-domain 0.000000278
Further Details:      
 
Domain Number 2 Region: 216-276
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.11e-20
Family EB1 dimerisation domain-like 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005642   Gene: ENSCAFG00000003796   Transcript: ENSCAFT00000006097
Sequence length 289
Comment pep:novel chromosome:CanFam3.1:19:9678823:9680767:1 gene:ENSCAFG00000003796 transcript:ENSCAFT00000006097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHRDKDYAEAGHRQWTWSRQEPRMAVNLYSTSVTSVNLSQHDMLAWINESLQLNLTKIEQ
LCSGAAYCQFMDMLFPGSTALKKVKFQAKLEHEYIQNLKILQAGIKRMGVDKISPVDKLV
KGKFQDNFEFVQWFKKFFDANYDGKDCDPVAARQGQDTAVAPSLVAPALNNPKKPLSSSS
AVPQRPTATHRTTATLKAGPGVVRKNPSVGNDDEAAELMQQVNVWKLTVQDLEKERDFYF
GKLKNIELICQENEGENNPVLQRILDILYATDEGFVIPDERGAHRRNKK
Download sequence
Identical sequences F6UNZ3
ENSCAFP00000005642 ENSCAFP00000005642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]