SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005691 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005691
Domain Number 1 Region: 306-530
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-33
Family Calponin-homology domain, CH-domain 0.00048
Further Details:      
 
Domain Number 2 Region: 3-124,297-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.05e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.086
Further Details:      
 
Domain Number 3 Region: 644-675
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000224
Family LIM domain 0.00078
Further Details:      
 
Domain Number 4 Region: 610-643
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000412
Family LIM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005691   Gene: ENSCAFG00000003824   Transcript: ENSCAFT00000006147
Sequence length 964
Comment pep:novel chromosome:CanFam3.1:12:66350607:66358367:-1 gene:ENSCAFG00000003824 transcript:ENSCAFT00000006147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQCLVVGAGPCGLRAAVELALLGARVVLVEKRTKFSRHNVLHLWPFTIHDLRALGAKKFY
GRFCTGTLDHISIRQLQLLLLKVVLLLGVEIHWGVTFTGLQPPPKKGEPPWRPGKKRPPG
PTGQLWVQKVSLLLRGNSSLKVSFTVREMRGKLAIGITVNFVNRRTVEETQVPEISGVAR
IYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKKQCLLRLGVLRQDWPEIDRLLGSA
NVVPEALQRFVRAAADFATNGKLGKLEFARDAHGRPDISAFDFTSMMRAESSARVQEKDG
ARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMVKRWAEGAGPLEVLAERESLYQLL
SQTSPENMHRNVAQYELDPATRYPTLNLRAVTPHQVQDLYDVMAKEPRRRPSDKPDAGKP
ATGPAGTQEELLRWCREQTAGYPGVHVTDLSSSWADGRALCALVHRLRPGLLEPAELRGV
GALEATAWALKVAEHELGIPPVLSAKAVVAGSDPLGLIAYLSHFHSTFKNTAHGPGGPEG
PARQGFPGTSSAVLFLGKLQRTLQRPRAQENREDTGGKKPRLEGEAKTPSTEEPPVPESG
VPPTPPSQHQEAGAGDLCALCGEHLYILERLCADGRFFHRSCFRCHTCEATLWPGGYRQH
PEDGHFYCLQHLPQEGPEEDGGDQGPGSQDLPAAEEASMPSGPSPAVTPPEGTRAAPSPG
QPTQPTRRLIRLSSPERQRLSSLQLTPEPELEPPPKPPRSCAALARQALEGSFVGWGMPV
QSPQVLVATEEEQEQSASSSEEEEEEAAGETTLWARHGAVTQRLLGLLSRAPQAVQRRLH
EIETALGDLEAEGMKVELAWRSQGGSPEQQNTLWMEQLLQLVQKKNSLLAEEAELMITVQ
ELNLEEKQWHLDQELRGYLNQEGALKTPADRQAEEQLLKKLLDVVNQRDTLIRFQEELRL
SELA
Download sequence
Identical sequences F1PCD9
ENSCAFP00000005691 ENSCAFP00000005691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]