SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006909 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006909
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.3e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 201-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 8.37e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006909   Gene: ENSCAFG00000004627   Transcript: ENSCAFT00000007456
Sequence length 281
Comment pep:novel chromosome:CanFam3.1:17:20971460:21026759:1 gene:ENSCAFG00000004627 transcript:ENSCAFT00000007456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAP
PCILRKNPPSARNGGHETDAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences A0A250YEB6 A0A2K6EXX5 D2GXN0 E2RDE0 I3MPU3 L8IJA8 L8YFF3 W5QCK1
ENSSTOP00000013877 ENSOARP00000020448 ENSCAFP00000006909 ENSAMEP00000002110 ENSTBEP00000011794 ENSAMEP00000002110 9913.ENSBTAP00000011696 ENSTBEP00000011794 ENSCAFP00000006909 XP_003787507.1.62490 XP_004268168.1.21590 XP_004268169.1.21590 XP_004394948.1.74151 XP_004418306.1.5094 XP_004765435.2.14098 XP_004765436.2.14098 XP_005213055.1.76553 XP_005895771.1.15283 XP_005978985.1.78601 XP_006162246.1.99106 XP_006743711.1.47382 XP_006930484.1.62641 XP_007108474.1.24612 XP_007191361.1.59432 XP_007191362.1.59432 XP_007937062.1.48129 XP_008511259.1.77740 XP_008511260.1.77740 XP_008582218.1.73410 XP_010838906.1.44457 XP_011233289.1.58354 XP_012013623.1.54773 XP_012013624.1.54773 XP_012013625.1.54773 XP_012013626.1.54773 XP_012021618.1.66739 XP_012021633.1.66739 XP_012021636.1.66739 XP_012415927.1.74151 XP_012507928.1.63892 XP_012643652.1.48125 XP_012643653.1.48125 XP_012643654.1.48125 XP_012643655.1.48125 XP_012659215.1.62490 XP_012918434.1.14098 XP_013212869.1.77405 XP_013378112.1.28644 XP_014637253.1.5094 XP_014637256.1.5094 XP_014705808.1.49734 XP_014705809.1.49734 XP_014919614.1.86478 XP_014919615.1.86478 XP_014949747.1.66739 XP_015335374.1.40921 XP_017506203.1.32401 XP_017911017.1.57651 XP_019305264.1.44245 XP_019305273.1.44245 XP_019305280.1.44245 XP_019683345.1.62641 XP_019826128.1.53367 XP_020034327.1.5219 XP_020741972.1.74333 XP_020741973.1.74333 XP_020741974.1.74333 XP_020741975.1.74333 XP_021553076.1.83697 XP_021553077.1.83697 XP_532901.1.84170 XP_859989.2.84170 ENSSTOP00000013877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]