SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007545 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007545
Domain Number 1 Region: 14-142
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.19e-24
Family Calponin-homology domain, CH-domain 0.00088
Further Details:      
 
Domain Number 2 Region: 957-1070
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000266
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007545   Gene: ENSCAFG00000005061   Transcript: ENSCAFT00000008147
Sequence length 1617
Comment pep:known chromosome:CanFam3.1:22:29416388:29620538:1 gene:ENSCAFG00000005061 transcript:ENSCAFT00000008147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPGADCAVAFAEAQRWVEAVTEKNFETKDFRASLENGVLLCDLVNKLKPGVIKKINRL
STPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVRQEETDRRVKNVLITLYW
LGRKAQSNPYYNGPYLNLKAFENLLGQALTKALEDTSCLKRSGRDSGYGDIWCAERGDFP
TSPGNHKREDSFESLDSLGSRSFTSCSSDITLRGGREGCESDTDSEFTSRMQDYNKDDMS
YRRISAIEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKNEDNRRSWASPVYPEADGTF
PSNERRTWGTNVENCPTVQETSSSSCYLEEEREKTRTPNTIKDDLYVRKLSPIMPNPGNA
FDQFLPKCWIPEDVNWKRIKRETYKPWYKEFQGFSQFLLLQALQTYSDDILASETNIKID
PTAGPRLITRRKNLSSAPGCKRDDLEMPTLDPDLENDDFFVRKTGAFHANPYVLRAFEDL
RRFSEPDDSVERDIILQCREGELVLPDLEKDDMIVRRIPAQKKEVPLSGAPERYQPVPLP
EPWTLPPEIQAKFLCVLERTHPSKEKRKSCGVLVPSSRKKRDDMLTRKIQSWQLGTTVPP
VSFTPGPCSEADLRRWEAIREASRLRHRKRLMVERLFQKIYGENGSKSMSDVSAEDIQNL
RQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSER
SSKTFKEMLQDRESRNQMSTVTSRRRLHSNDDVLNEEMLSPTLTMSEASYQSERVEEKET
MYSTEIPKQDSTTFVKREDAVTTDIQLPSQSPMEEQLPDSLSSQHSPSTRMQSTRVSASL
PRSYQKTDTARLTSVVTPRPFGSQTRGISSLPRSYTMDDAWRYNGDVEDDKRTQNSFVST
SVQKPDTSQLASSKSSETEIAAVGEGVMGLPSPTPSFSSLSQDQAATSKATLSSSSGPDL
VSELGEGRSSPQTEVSRSQDQFSDMRISINQTPGSGLDFGFTVKWAFSGIFVASVEAGSP
AEFSQLQVDDEIIAINNTKFSYKDTKEWEATMANAKETGNLVMDIRRYGKSGSPETKWID
TTSGIYNSDKSSSLSITTDFSESLQHSNTESKEINGIRDESNTFESKASEPISLKNLKRR
SQFFEQGSSDSVVPDLPVPTLSTPSRWAWDQEEERRRQERWQREQDRLLQEKYQREQEKL
REEWQRAQQEAERENYKYLNEERMVLSSHSLSRPTREPAVATWETAWGEGSKSSDREGTR
AGEEERRPQQKEDEEEDQRKRLQEQLALERERKLKEQQDQEEQERRRRQEEAQEQKPQAE
RERETTVKIYQYRRPIDSYDIPKREEQSSGLLPSDRNKSRSTTELDGYPANKNGGNKYSD
QIGSTSSSQRSSKKEQAPSEAELERQQILQEMRKRTSLLNDNSWIRQRSSSVNKEPICLP
GIMRRGESLDNLDSPRSSSWKPSPWFNQPSGVRASSSVQDFSRPPPQLVSTSNRAYMRNP
SSSIPPPSSAGSVQTTTAPSPTPHSPSPSLSQSGSQLRNRSVSGKRVCSYCNSILGKGAA
MIIESLGLCYHLHCFKCVACECDLGGSSSGAEVRIRNHQLYCNDCYLRFKSGRPTAM
Download sequence
Identical sequences F1PG65
ENSCAFP00000007545 XP_013961832.1.84170 ENSCAFP00000007545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]