SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007956 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007956
Domain Number 1 Region: 51-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-90
Family Calponin-homology domain, CH-domain 0.00000226
Further Details:      
 
Domain Number 2 Region: 2414-2532
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 304-424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-29
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 4 Region: 1570-1725
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-28
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 5 Region: 433-535
Classification Level Classification E-value
Superfamily Spectrin repeat 7.32e-23
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 6 Region: 850-983
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-22
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 7 Region: 1891-2045
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1783-1935
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1255-1407
Classification Level Classification E-value
Superfamily Spectrin repeat 4.46e-20
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 10 Region: 1481-1608
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 11 Region: 537-643
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-18
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 12 Region: 745-840
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 2017-2111
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-16
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 14 Region: 1088-1202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000024
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 15 Region: 641-779
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000518
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 16 Region: 1415-1513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000118
Family Spectrin repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000007956
Domain Number - Region: 998-1082
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0149
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007956   Gene: ENSCAFG00000005286   Transcript: ENSCAFT00000008586
Sequence length 2569
Comment pep:novel chromosome:CanFam3.1:1:113166306:113240934:-1 gene:ENSCAFG00000005286 transcript:ENSCAFT00000008586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQIPGEVDNMEGLPATNNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIADLYADLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRET
RSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANY
NLQRAFRTAEQHLGLTRLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGK
VLDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEK
PVKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGQLEKAEHEREAALRA
ELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA
AYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQK
IFQEMVYMVDWMEEMQAQLLSRECGQHLVEAEDLLQKHGLLEGDIAAQSERVEALNAAAL
RFSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESW
ARDKERLLEAAGGGGGGGAAGPGGSAGGAHDLSSTARLLAQHKILQGELGGRRALLQQAL
RRGEELAAAGGAVGPGADTVHLAGLAERAASARRRWQRLEEAAARRERRLQEARALHQFG
ADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVGGLRRQLATL
GGASGAGPLVVALQVRVVEAEQLFTEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGE
KEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVR
SCQDHLNSRWNRIVELVEQRKEEVSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGA
LQWRLSGLEAALQALEPRQAALQEEAALLAVRFPTQAARLHQGAEELGAEWGALASAAQA
CGEAVAAAGRLQRFLHDLDAFLDWLVRAQEAAGGVEGPLPGSLEEADALLARHAALKEEV
DQREEDYARIVAASEALLASDGAELGPGLALDEWLPHLELGWHKLLGLWEARRDALVQAH
VYQLFLRDLRQARAVLRNQEMALSGPELPGTVESVEEALKRHRDFLTTMELNQQKMQVAV
QAAEGLLRQGNAYGEQAQEAVTRLLEKSQENQLRARQWMQKLHDQLGLQHFLRDCHELDG
WIHEKMLMARDGTREDGHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAA
SVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPG
GDLATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVR
LLEPLQERRRLLLASKELHQVAHDLDHELAWVQERLPLAMQTERGNGLQAVQQYIKKNQG
LRREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGQEQLQGAWSGLREAAERRQQVLDA
AFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQ
LSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVGLEQQYWLYQLSRQVDEL
EHWIAEKEVVAGSPELGQDFEHVTVLQEKFSEFANETGTAGRERLAAVNQMVDELIECGH
TAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPR
LTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQE
VLQGWKELLAACEDARLHVSSTADALRFHSQARDLLSWMDGIASQIGAADKPRDVSSVEV
LMNYHQGLKTELEARGPELTACQELGRSLLLNKSAMADEIQAQLDKLGTRKEEVSDKWDR
HWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAA
WEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYDRGLEP
LARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPPAPPAAPENVVETPG
ALAAVAAVAEQVRPRPERQESADRAEELPRRRRPERQESADQSEEAARRRRPERQESAEH
ETAHSLTLGRYEQMERRRERRERRLERQESSEQEMPTRGELAKGKATLADIVEQLQEKEA
GPGLPVGPSLPQPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGS
RRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELG
FYKDAKGPASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEM
NGWLEAVAASVGEHAEIARWGQTLPTTSSTDEGNPKREAGERRASGRRK
Download sequence
Identical sequences E2QWM4
ENSCAFP00000007956 ENSCAFP00000007956 XP_541613.2.84170 9615.ENSCAFP00000007956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]