SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008618 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008618
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-36
Family Calponin-homology domain, CH-domain 0.00081
Further Details:      
 
Domain Number 2 Region: 2011-2148
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000231
Family Nucleotide and nucleoside kinases 0.089
Further Details:      
 
Domain Number 3 Region: 2040-2087,2158-2245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000225
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008618   Gene: ENSCAFG00000005746   Transcript: ENSCAFT00000009286
Sequence length 2376
Comment pep:known chromosome:CanFam3.1:15:20581240:20937247:1 gene:ENSCAFG00000005746 transcript:ENSCAFT00000009286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLGVASKLRQPAVGSKPVHTALPIPNLGTTGSQPYSSRPLELTETESSMLSCQLTLKS
TCEFGEKKPLQEKAKETEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQII
ANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLS
RYKQQQHHQQQYYQSLAELQQRVSQASSQAEASQAKAQQDMQSSLAARYATQSNHSGIAT
SQKKPTRLPGPSRVPAAGSSSKVQGASNLNRRSQSFNSIDKNKPPNYTNGNEKDSSKGPQ
PSSGVNGNPQPPGTAGQPPASAIPSPSACKPWRSKSMNVKHSATSTMLAVKQSSPATSPT
PPADRLKPPVSEGVKTTSSGQKSMLEKFKLVNARTALRPPQSSSSGPSDGGKDDDAFSES
GDTEGFNSGLNSGGSTSSSPKASPKLAPPKAGSKNLSNKKSLLQPKDKEEKNRDKNKVCT
EKPVKDEKDQVTETAPKKTSKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPMAKPT
VSPGSAVSKESEKFRTTKGGPPQGSPKPSAAEKAEKAGAPGCLAPPEGRDGSAGPPAGGG
AVQLPQQQQQQQHSHPNTATVAPFIYRSHSENEGTSLPSADSCTSPTKMDLSYNKTAKQC
LEEISGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDSTVTTEVNGRT
IPNLTGRPTPMTWRLGQACPRLQAGDAPSLGAGYPRSGTGRFIHTDPSRFMYTTPLRRAA
VSRLGNLSQIDMSEKASSDLDMSSEVDVGGYMSDGDILGKSLRADDINSGYMTDGGLNLY
TRSLNRIPDTATSRDVIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDDLNTTSSVS
SYSNITVPSRKNTQLKTDSEKRSTTDETWDTTEELKKPEEDFDSHVDSGGKWKGVSSGLP
EDPEKTGQKASLSISQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKTPL
KGSSLQRSPSDAGKSSGDEGKKPPSGIGRSAAPGSFGFKKPSGVGSSTMITSSGATITSG
SATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDGVLHVSSKTSLQYRSLPRPSKSSTSGI
PGRGGHRSSTSSIDSNVSSKSAGASTSKLREPTKIGSGRSSPVTVNQTDKEKEKVAVSDS
ESVSLSGSPKSSPTSASACGTQGLRQPGSKYPDIASPTFRRLFGAKAGGKSASAPNTEGV
KSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSL
ASSPASVHSFTSGGLVWAANLSSSSAGSKDTPSYQSLTSLHTSSESIDLPLSHHGSLSGL
TTGTHEVQSLLMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEGKEWLRSHST
GGLQDAGNQSPLLSPSAMSSSATGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSF
DLYDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEEKAHSE
QIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIE
LRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIGSGN
DADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKVPHG
AGDCGSTSMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELRE
KELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEMLKAENDRLKAETGNTAKPARPPSES
SSSTSSSSSRQSLGLSLNNLNITESVTSDILLDDAGDGTGHKDGRSVKIIVSISKGYGRA
KDQKSQAYLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSTSLGLSSDCIASYCIGDL
IRSHSLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEH
HRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQ
CSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELH
HNFRWVLCANHTEPVKGFLGRYLRRKLIEMEIERNIRNNDLVKIIDWIPKTWHHLNSFLE
THSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRAPWEDP
SKWVLDTYPWSSASLPQDGPALLQLRPEDVGYEGCISTKEATTSKHIPQNDTEGDPLMNM
LMKLQEAANYSGTQSCDSDSTSHHEDILDSSLESTL
Download sequence
Identical sequences F1PNY1
ENSCAFP00000008612 ENSCAFP00000008618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]