SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009209 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009209
Domain Number 1 Region: 160-361
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-51
Family DBL homology domain (DH-domain) 0.00000000498
Further Details:      
 
Domain Number 2 Region: 353-477
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-35
Family Pleckstrin-homology domain (PH domain) 0.0000147
Further Details:      
 
Domain Number 3 Region: 85-154
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-25
Family SH3-domain 0.0000482
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009209
Domain Number - Region: 4-45
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00645
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 
Domain Number - Region: 659-715
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.017
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009209   Gene: ENSCAFG00000006116   Transcript: ENSCAFT00000009923
Sequence length 723
Comment pep:novel chromosome:CanFam3.1:22:59233491:59302771:1 gene:ENSCAFG00000006116 transcript:ENSCAFT00000009923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSFQTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGAQP
SHSRTSKLFQGQYRSLDMTDNSNSQLVVRAKFNFQQTNEDELSFTKGDVIHVTRVEEGGW
WEGTHNGKTGWFPSNYVREMKPSEKPVSPKSGALKSPPKGFDTTAINKSYYNVVLQNILE
TENEYSKELQTVLSTYLRPLQTSSRLSSANTSYLMGNLEEICSFQQMLVQSLEECTKLPE
AQQRVGGCFLNLMPQMKTLYLAYCANHPSAVNVLTEHSEQLGEFMEARGASSPGILVLTT
GLSRPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQI
LTEAIRSWEGDDITTLGSVVYMSQVMVQCAGSEEKNERYLLLFPNILLMLSASPRMSGFI
YQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLHEWVDHLQKQTKVTS
VGNPTIKPHSVPSHTLPSHPIAPSSKHADSKPVPLTPAYHTLPHPSHHGTPHTTINWGPL
EPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFALR
KSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESAPQVLLPEEEKMIVEETKSNGQT
VIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDE
TNL
Download sequence
Identical sequences E2R427
ENSCAFP00000009209 ENSCAFP00000009209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]