SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009287 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009287
Domain Number 1 Region: 6-81
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000393
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009287
Domain Number - Region: 197-232
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0288
Family Trimerization domain of TRAF 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009287   Gene: ENSCAFG00000006190   Transcript: ENSCAFT00000010012
Sequence length 236
Comment pep:novel chromosome:CanFam3.1:24:17574741:17577827:1 gene:ENSCAFG00000006190 transcript:ENSCAFT00000010012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPAN
SLQQKLSNWGHLNRKVLNKLNFSVPEDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQ
GTSSLQELAPQDGTGYMDVGLSRKAGGEGALDPQGGGQLREGRLPGPRPPGYSQAVQGDP
SFVLQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIDDLSRRLQQAERKQR
Download sequence
Identical sequences E2R239
XP_542915.2.84170 ENSCAFP00000009287 ENSCAFP00000009287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]