SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010246 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010246
Domain Number 1 Region: 44-201
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.64e-29
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 
Domain Number 2 Region: 214-292
Classification Level Classification E-value
Superfamily GAS2 domain-like 7.98e-28
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010246   Gene: ENSCAFG00000006883   Transcript: ENSCAFT00000011056
Sequence length 661
Comment pep:novel chromosome:CanFam3.1:15:39635909:39657574:1 gene:ENSCAFG00000006883 transcript:ENSCAFT00000011056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMQPAIQVWFGEDLPLSPRSPLTPRHGPGLADVCQYDEWIAVRHEATLLPMQEDLSIWL
SGLLGTEVKAERLLEELDNGVLLCQLIDVLQNMVKACNSEELENFPMRKVPCKKDAASGS
FFARDNTANFLHWCRHIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVL
VKLEKEIELEETLLNTSGPEDSISIPKSCCQHEELHEAVKHIAEDPPCSCSHRFSIEYLS
EGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQKG
VSNESVPDSSARTPQPPDMNPLSAVSLFQKQKSKPGPPVGVARSKEKQVRPPGGLLPAAP
LNGGDLGSSHLKLKSSKGAAKKPQAPSGSAAGASTSAAAAPEGSAREPRPLRRGAPPSAP
EARLLPAPRPARPPAAALLPSQPAGKTEPKPLKPAAVRARVGPESPAAAPSASCERPEPR
RANTHLRPRPSPALRPPAKMTKSGPKSTAPRPGPRCPPPAGAARAAPSPSAAAAAAKAAQ
DSEGKAVVPGAKKQPPGQSTSPKRGPGRPRPPGRAPLSLVSLPQASAQSPTARGAARGAA
RGAAGGQPPAPRPPGRGGGPAATRAPPAPRKEAASAGKKPTAKKEVDDHYFVMTGSKKPR
K
Download sequence
Identical sequences E2RMV2
ENSCAFP00000010246 ENSCAFP00000010246 XP_005629334.1.84170 XP_013975166.1.84170 XP_539741.4.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]