SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010844 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010844
Domain Number 1 Region: 24-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-51
Family Calponin-homology domain, CH-domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 217-277
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.84e-21
Family EB1 dimerisation domain-like 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010844   Gene: ENSCAFG00000007306   Transcript: ENSCAFT00000011702
Sequence length 290
Comment pep:known chromosome:CanFam3.1:24:22130125:22163913:1 gene:ENSCAFG00000007306 transcript:ENSCAFT00000011702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FERDEDGIEAGHRQWTRSRREPKMAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQ
LCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLV
KGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLSSSS
AAPQRPIATHRTTATPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFY
FGKLRNIELICQENEGENNPVLQRIVDILYATDEGFVIPDEGGPQEEQEE
Download sequence
Identical sequences F6Y5Z5
ENSCAFP00000010844 ENSCAFP00000010844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]