SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011340 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011340
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.34e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1017-1127
Classification Level Classification E-value
Superfamily E set domains 3.38e-36
Family Filamin repeat (rod domain) 0.000000684
Further Details:      
 
Domain Number 3 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 2.07e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 4 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 5.94e-32
Family Filamin repeat (rod domain) 0.000000846
Further Details:      
 
Domain Number 5 Region: 1623-1738
Classification Level Classification E-value
Superfamily E set domains 6.47e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 6 Region: 1525-1640
Classification Level Classification E-value
Superfamily E set domains 7.34e-31
Family Filamin repeat (rod domain) 0.0000281
Further Details:      
 
Domain Number 7 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 2.13e-29
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 8 Region: 1419-1460,1492-1558
Classification Level Classification E-value
Superfamily E set domains 2.63e-29
Family Filamin repeat (rod domain) 0.00000605
Further Details:      
 
Domain Number 9 Region: 720-844
Classification Level Classification E-value
Superfamily E set domains 4.74e-29
Family Filamin repeat (rod domain) 0.00079
Further Details:      
 
Domain Number 10 Region: 1848-1943
Classification Level Classification E-value
Superfamily E set domains 2.07e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 11 Region: 252-365
Classification Level Classification E-value
Superfamily E set domains 2e-27
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 12 Region: 643-753
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 13 Region: 2219-2315
Classification Level Classification E-value
Superfamily E set domains 5.4e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 14 Region: 2028-2124
Classification Level Classification E-value
Superfamily E set domains 8.67e-27
Family Filamin repeat (rod domain) 0.00000342
Further Details:      
 
Domain Number 15 Region: 829-943
Classification Level Classification E-value
Superfamily E set domains 1.2e-26
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 16 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 2.6e-26
Family Filamin repeat (rod domain) 0.00000353
Further Details:      
 
Domain Number 17 Region: 2542-2632
Classification Level Classification E-value
Superfamily E set domains 8.01e-25
Family Filamin repeat (rod domain) 0.0000152
Further Details:      
 
Domain Number 18 Region: 536-639
Classification Level Classification E-value
Superfamily E set domains 5.14e-24
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 19 Region: 2413-2504
Classification Level Classification E-value
Superfamily E set domains 7.34e-24
Family Filamin repeat (rod domain) 0.0000146
Further Details:      
 
Domain Number 20 Region: 2320-2411
Classification Level Classification E-value
Superfamily E set domains 7.34e-24
Family Filamin repeat (rod domain) 0.0000172
Further Details:      
 
Domain Number 21 Region: 352-448
Classification Level Classification E-value
Superfamily E set domains 1.26e-23
Family Filamin repeat (rod domain) 0.0009
Further Details:      
 
Domain Number 22 Region: 2141-2236
Classification Level Classification E-value
Superfamily E set domains 8.01e-21
Family Filamin repeat (rod domain) 0.0000125
Further Details:      
 
Domain Number 23 Region: 931-1034
Classification Level Classification E-value
Superfamily E set domains 9.81e-20
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 24 Region: 1939-2027
Classification Level Classification E-value
Superfamily E set domains 4.07e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 25 Region: 1787-1862
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000133
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011340   Gene: ENSCAFG00000007603   Transcript: ENSCAFT00000012236
Sequence length 2633
Comment pep:novel chromosome:CanFam3.1:20:32394484:32533275:-1 gene:ENSCAFG00000007603 transcript:ENSCAFT00000012236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEASGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
LQPGPHVVKVSFAGDTIPKSPFVVQVGEACSPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELSVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGKYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPREPGEYAVHIMCDDEDIKESPYMAFIHPAAGDYNPDLVQAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFSSPVPGDAVRDLDIID
NYDYSHTVKYTPTQQGSMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGQ
GQEFAIDTKGAGGQGKLDVTISSPSRKIVPCLVAPVAGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLQHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRAHIL
QSFTVDSSKAGLAPLEVRVLGPRADEMDSQSWRSPLKAISEFFKGDPKGDFTETGLVEPV
NIVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSS
YGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
EAVEEAPVNACSPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTATPEIVDNKDGTVTVRYAPTEVGLHEMHIRYMGGHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSEFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSDM
SAHVTSPSGRVTEAEIVSMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGAGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSIETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKEKGDYILAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences E2R0F2
XP_003432942.1.84170 ENSCAFP00000011340 ENSCAFP00000011340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]