SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011591 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011591
Domain Number 1 Region: 366-469
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-30
Family Calponin-homology domain, CH-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011591   Gene: ENSCAFG00000007843   Transcript: ENSCAFT00000012518
Sequence length 482
Comment pep:known chromosome:CanFam3.1:18:38620569:38632607:-1 gene:ENSCAFG00000007843 transcript:ENSCAFT00000012518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKEGKPTEDGTTVSPNTEAPETLGGGASAEEAKGSVEPTVKETPPVGAGKQERAAAED
GTSPELQGEANGLDEVKVAAKVEAELHKEDGGKEESTVAPQEMTDGKEETQPGPKEAEEA
LGTTLASGKQQADEKEAKPESQEEARVNDEAKAEPTQAAGEREAKTGAREADGKEEATTA
SQEKSDKTEEPTAEAQEKAGAPEAGSDAQTKAAVEAEAEAEPREADAMEEAEPGGPKEEQ
DQGVERESEEGAGAVPSSPEEWLESPTEEGSGLSPDGVGPDAAASGETSPSASESSPSDA
PQSPTEPPASQEKKKEKAPERRVSAPARPRGPRAQNRKAIVDKFGGAASGPTALFRNTKA
AGAAIGGVKNMLLEWCRAMTRNYEHVDIQNFSSSWSSGMAFCALIHKFFPDAFDYAALEP
TQRRHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTK
KK
Download sequence
Identical sequences E2R238
XP_540610.2.84170 ENSCAFP00000011591 ENSCAFP00000011591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]