SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011648 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011648
Domain Number 1 Region: 389-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-37
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 86-241,386-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.2e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 994-1027
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000661
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000011648
Domain Number - Region: 1028-1057
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000296
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011648   Gene: ENSCAFG00000007867   Transcript: ENSCAFT00000012580
Sequence length 1972
Comment pep:novel chromosome:CanFam3.1:21:35153041:35377021:1 gene:ENSCAFG00000007867 transcript:ENSCAFT00000012580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQTQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIIGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRADFLPADHPLSDFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTSMYASENAALVRERQSHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVR
PHQVKHLYITKELHQCPLERLGSVRRSMSLSRRELDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWGKNYGENADLGLAKSSISHNYLNLTFPR
KRTPRVDTQTEDNDMNKRRRKGFNNLDEPSAYPRRSLRSCPEDGSGKEAGSQNKVKSMAS
QLLAKFEENSRNPSLLKQECRVSGIGKPVLRISSDPPVNSRCPRPEEPTPGPSPPLKRQF
PSVVVTGHVLRELKQVSAGGECPSRPWRARAKSDLQLGGPENTAALPPTCQGALALSGVL
RRLQQVEDKIVQKRAQNLANREFHKKNIKEKAAHLASMFGHGDFPQNKLLSKGLSLTHPP
ASPSCLPSPDPAAASSPSTVDSVSPARKAKKSPSGFHFHPSHLRTVRPQLTVGKVSSGIG
AAAEVLVNLYMNDHRPKTQATSPDLESMRKVFPLNLGGSDTCYFCKKRVYVMERLSAEGH
FFHRECFRCSACATTLRLAAYAFDGDEGKFFCKPHFIHCKTNSQQRKRRAELKQQREEEG
TWKEQEAPRRDTPVESSCAAAAIGTPAGSPPDEPTSPKKPKSVLEPEPSDVDGGATSLLP
SEWTSVRISPGEDIVGQDMMAVCVLVTSDDSSSDAEPDCPGTKASSARPCEERPWQPGPR
PLPEPLTRHSSLREAPARGGSPQSSEEPHAVHALQRASSFQSPIPSKYQSWRRTFQSNST
PVNNERTLPPSKEPSEAPLSSSSLSSPSSSPPSFSSATLPGNSPDGFSLPQETADHLPSQ
VSRGHSGLSTPIFLRRARAKGVPKDMPLYLPHNQVLGQAEYCVVRPGEDGPTSPQPPSPA
EMASDGCPEAEAPLGDTRSLHKDPHPPGGQDKCLPDQELPCRAEEDSGGKNMGPREGAED
GSELSEGKKLGLRKLVLTPEQKTKLLDWDNSIPESVSPEARAPNAEKSPDKGRGGHVLKL
MRPLLPPQTARETPPALGKAQEKMGIPAERAPPKSPLRLIANAIRRSLEPLLPTSEGGRK
AFARQESKALPASQPSQPHACTRSFSLRKTSSNKDCNQQSPGKDSASRASAFFSLGSSPA
KAAQPSYPSPPDPVHRTHSLPTRPSKVFPALMSPPCHKIDDVPTLLEKVSLQETFPDASR
VPKKRISLFSSLKLKDKSCESSLQESKQRKDLQDLFSTPRGKGEPVDNALAQPRHSTCLG
PRVPPPSPDKDASPQHIPIQMQVTGATSSTSNTSISSADEDFHPQPSLRSKERKTLRRRR
KLEKATKQLVKQEELKRLHKAQAIQRQLEEVEEQQRASEIQGVRLEKALRGETDSGTQDE
AQLLQEWFKLALEKNKLMRYESELLIMAQELELEDHQSRLEQKLRQKMLKEESQKDENDL
NEEQELFSEMMQVIEQRDRLVCSLEEQRIKEKAEDQHFESFIFSRGCQLSRT
Download sequence
Identical sequences E2QX90
ENSCAFP00000011648 ENSCAFP00000011648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]