SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011694 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011694
Domain Number 1 Region: 52-221,267-348
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.31e-45
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011694   Gene: ENSCAFG00000007895   Transcript: ENSCAFT00000012627
Sequence length 373
Comment pep:novel chromosome:CanFam3.1:21:35481240:35538051:1 gene:ENSCAFG00000007895 transcript:ENSCAFT00000012627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSFKFRPSPIYVLLLLLPVLLVSQPTKGFIWSDRSLKKAGWSKFYPIFVEVSELQEEG
MNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGER
IIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPR
SIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEE
ITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADG
VYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEGTLLFP
GFKTQKPFPCTGL
Download sequence
Identical sequences J9NV14
ENSCAFP00000011694 ENSCAFP00000037006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]