SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011696 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011696
Domain Number 1 Region: 120-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-158
Family Calponin-homology domain, CH-domain 0.00000000341
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 2.51e-19
Family Calmodulin-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011696   Gene: ENSCAFG00000007897   Transcript: ENSCAFT00000012629
Sequence length 629
Comment pep:novel chromosome:CanFam3.1:23:38243024:38345567:1 gene:ENSCAFG00000007897 transcript:ENSCAFT00000012629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSTTVISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKIL
AVADNNKDGKITFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSY
SEEEKVAFVNWINKALEDDPDCKHLLPMNPSDGSLFKSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTISENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLLA
DIEISRNEALIALLKEGEDLEELMKLSPEELLLRWVNYHLTNAGWPNINNFSQDIKDSRA
YFHLLNQIAPKGDQGDEPAITIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVVSG
NPKLNLAFVANLFNTYPCLHKPDNDIDINLLEGESKEERTFRNWMNSLGVNPYINHLYSD
LADALVIFQLYEMIRVPVKWSRVNKPPYPALGGNMKKIENCNYAVELGKTEAKFSLVGIA
GQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNETLKSAQKPTSIS
SFKDKTISTSLPVLDLIDAIAPNAVRQEMIKRENLSEEDKLNNAKYAISVARKIGARIYA
LPDDLVEVKPKMVMTVFACLMGKGLNKIK
Download sequence
Identical sequences E2QWB2
XP_542817.3.84170 ENSCAFP00000011696 ENSCAFP00000011696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]