SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000013676 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000013676
Domain Number 1 Region: 856-983,1015-1220
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-80
Family p120GAP domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-37
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1450-1548
Classification Level Classification E-value
Superfamily RGC domain-like 2.09e-33
Family RGC domain 0.0000114
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000013676
Domain Number - Region: 649-744
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00133
Family Motor proteins 0.06
Further Details:      
 
Domain Number - Region: 572-603
Classification Level Classification E-value
Superfamily WW domain 0.00964
Family WW domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000013676   Gene: ENSCAFG00000009293   Transcript: ENSCAFT00000014783
Sequence length 1548
Comment pep:known chromosome:CanFam3.1:3:29894078:30134568:-1 gene:ENSCAFG00000009293 transcript:ENSCAFT00000014783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDERRRQNMAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMV
SEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRMIY
CIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANEL
SVDEAALHAAVIAINEAIEKGIAEQTIKTLRNPNAVLTLVDDSLAQEYQKELWEAKKRKE
ENARLKNNCISEEERDAYEELLTQAEIQGNINKVNRLAAVDHINAAVQEGDPENTLLALK
RPEAQLPAVYPFAAVMYQNELFNLQKQNAMNYLAHEELLIAVEMLSAVALLNQALESNDL
VSVQNQLRSPTIGFNNLDESYVERYTNALLTIKLEALSQGQDNLSWNEIQNCIDMVNIQI
QEENDRIVAVGHINEAIDEGNPLKTLDTLLLPTAKIKNVDPDYAQHYQDVLYHAKTQKLM
DSESVSKVLWLDEIQHAVNEANMDKDKAKQWITLVIDVNQCLEKEKPSDILSLLKPSMPN
TNDIIPECADRYYNALAKAKEHKSKSVSAEGSWLKLFLQDKYEYYYNIDSKEISWVMPES
YLPKESWLMAKEIEDIIEEVTTDYVREKMWSASDDLLLRLQATSAGSLLRKEYEARKSYL
YEQEKHVVKIQAFWKGYKQRKAYSCRRQMFVDNTNSIVKIQSWFRMVTTRRNYLSRLQYF
RDHKNEIVKIQSLLRANKARDDYKTLVGSENPPLTVIRKFVHLLDQSNLDFQEELEVARL
REEVVTKIRGNQQLEKDLNLMDIKIGLLVKNRITLEDVISHRTKLNKKKGGEMQILTNTD
NQGIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNKSTKFMDTVIFTLYNYAS
NQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNTLRQLLAP
VVKEILDDKSLTINTNPVEVYKAWVNQLETQTGEASKLPYDVTTEQALTYPEVKNKLEAS
IENLRRVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIREKFPDATEDELLKIVGNLLYYR
YMNPAIVAPDGFDIIDMTAGGQINPDQRRNLGSVAKVLQHAASNKLFEGENEHLSSMNNY
LSETYHEFRKYFKEACNVPEPEEKFNMDKYTDVVTVSKPVIYISIEEIISTHSLLLEHQD
AIAPEKQDLLNELLESLGEVPSVESFLGEGAVDPNDPNKANTLNQLAKTEISLYLTSKYD
LGDGEAIDGQSLMIKTKKLIIDVIRNQPGNTLTEILETPATTQQETDHAKDMVSRAIIDS
QAPEEMKHSQSMVEDAQLPLEQKKRKIQRNLRTLEQTGHVSSKNKYQDILNEIAKDIRNQ
RLHRKLRKAELAKLQQTLKALNEKAAFYEEQINYYDTYIKTCVDNLKRRNARRSIKLDGK
GEPKGAKRSKPVRYTAAKLHEKGVLLGVDDLQTNQFKNVTFDIVSTEDVGIFDVRSKFLG
VDMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK
Download sequence
Identical sequences F1PSQ0
ENSCAFP00000013676 XP_005618244.1.84170 ENSCAFP00000013676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]