SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014399 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014399
Domain Number 1 Region: 10-194
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-36
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 2083-2224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000443
Family Extended AAA-ATPase domain 0.06
Further Details:      
 
Domain Number 3 Region: 2118-2153,2231-2347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000227
Family Nucleotide and nucleoside kinases 0.089
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000014399
Domain Number - Region: 1652-1728
Classification Level Classification E-value
Superfamily Tropomyosin 0.00719
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 1899-1926
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0889
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014399   Gene: ENSCAFG00000009777   Transcript: ENSCAFT00000015561
Sequence length 2454
Comment pep:known chromosome:CanFam3.1:21:41904535:42177813:1 gene:ENSCAFG00000009777 transcript:ENSCAFT00000015561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKS
QALQEPAGEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAQ
IIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGL
FFSLSRYKQQQQQPQKQHLSAPPPPAVAQAAGAPPQCQAGTPQQQVPATPQAPGQPLQPA
PHQQSKAQAEMQSSASSKDSSQSKIIRFTLGQKKISRLPGPTARVSAAGSEAKTRGGSAT
ANNRRSQSFNNYDKSKPVTSPLPPPPPSSHEKEPLASPASSHPGMSENAPAPLESGGTST
PANSSASSAIPQPGAASKPWRSKSVSVKHSATSSMLSVKQPVPETPRPTPEAMKPAPNNQ
KSMLEKLKLFNSKGASKAGEGPGSRDTSCERLEILPTFEESEEMEATGRSLSVAGPASNS
PKIALKGIAQRTFSRALTNKKSSPKGSDKEKEKQQREKEKEKSKDLAKRASVTERPELRE
APKEDPSVAVVTEVPKKSSKIASFIPKGGKLNSAKKEAAAPSHSGIPKPGMKSMPGKSPS
APAPSKEVERSRGGKPSSGLPQQKPQLDGRHSSSSSSLASSEGKGPGGTTLNHSISSQTV
SGSVGTTQTTGSNTVSVQLPQPQQQYNHPNTATVAPFLYRSQTDTEGNVTAESSSAGVSM
EPSHYTKSGQPALEELTGEDPEARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTF
DTNVTTEISGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTES
GRYVYSAPLRRQLASRGSSVCHVDVSDKAAEEMDLEGIRMDAPGYMSDGDVLSKNIRTDD
ITSGYMTDGGLGLYTRRLNRLPDGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDTI
DNLSTDDINTSSSISSYANTPASSRKNLDVQTDAEKHSQVERGSLWSGDDVKKSDGGSDS
GIKMEPGSKWRRNPSDVSDESDKSTSGKKNSVISQTGSWRRGMTAQVGITMPRTKAAAPA
GALKTPGTGKTDDAKVSEKGRLSPKASQVKRSPSDAGRSSGDESKKPLSSSSRTPSANAN
SFGFKKQSGSAAGLAMITASGATVTSRSATLGKIPKSSALVGRSTGRKTSMDGAQNQDDG
YLALSSRTNLQYRSLPRPSKSTSRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTAL
GSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPMSSAAQATLQPGAKYPDVASPT
LRRLFGGKPNKQVPIATAESMKNSVVISNPHAASTQQGNLESPSGSGVLSSGSSSPLYSK
NVEMNQSPLASSPSSAHSGPSNSLTWGTNASSSSAVSKDGLGFQSVSSLHTSCESIDISL
SSGGGLSHNSSTGLIASSKDDSLTPFVRTNSVKTTLSESPLSSPAASPKFCRSTLPRKQD
SDPHLDRNTLPKKGLRYAPTSQLRTQEDAKEWLRSHSAGGLQDTAANSPFSSGSSVTSPS
GTRFNFSQLASPTTVTQMSLSNPTMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRTM
SRSGSFRDGFEEVHGSSLSLVSSTSSIYSTPEEKCQSEIRKLRRELDASQEKVSALTTQL
TANAHLVAAFEQSLGNMTIRLQSLTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVI
NTPELNCKGNGTSQSADLRIRRQHSSDSVSSINSATSHSSVGSNIESDSKKKKRKNWVNE
LRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRGSHSNSLIS
ECIDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAEND
RLKSESQGSGCSRAPSQVSLSASPRQSMGLSQHSLNLTESTSLDMLLDDTGECSARKEGG
RHVKIVVSFQEEMKWKEDSRPHLFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQ
LGLNSDSVLGYSIGEIQRSNTSETPELLPCGYLVGENTTISVTVKGLAENSLDSLVFESL
IPKPILQRYVSLLVEHRRIILSGPSGTGKTYLANRLSEYLVLREGRELTDGVIATFNVDH
KSSKELRQYLSNLADQCTSENNAADMPLVIILDNLHHVSSLGEIFNGLLNCKDHKCPYII
GTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNMELVKI
IDWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAV
REGLQLYGRRAPWEDPAKWVMDTYPWAASPQQHEWPPLLQLRPEDVGFDGYSMPREGSAS
KQMPPSDAEGDPLMNMLMRLQEAANYSSPQSYDSDSNSNSHHDDILDSSLESTL
Download sequence
Identical sequences F1P9L3
XP_005633808.1.84170 ENSCAFP00000014409 ENSCAFP00000014399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]