SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014488 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014488
Domain Number 1 Region: 39-280
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.66e-72
Family Calponin-homology domain, CH-domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 300-420
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-28
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 2115-2253
Classification Level Classification E-value
Superfamily Spectrin repeat 7.8e-25
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 1268-1418
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-24
Family Spectrin repeat 0.00071
Further Details:      
 
Domain Number 5 Region: 2314-2467
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-23
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 2525-2680
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-22
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 3275-3422
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-22
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 8 Region: 600-745
Classification Level Classification E-value
Superfamily Spectrin repeat 5.26e-22
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 9 Region: 1574-1709
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-22
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 2630-2785
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-20
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 11 Region: 2896-2996
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-20
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 12 Region: 1474-1615
Classification Level Classification E-value
Superfamily Spectrin repeat 4.64e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 13 Region: 1692-1835
Classification Level Classification E-value
Superfamily Spectrin repeat 8.76e-18
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 14 Region: 2739-2890
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 15 Region: 862-999
Classification Level Classification E-value
Superfamily Spectrin repeat 3.11e-17
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 16 Region: 3106-3209
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 17 Region: 1105-1216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000112
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 18 Region: 1891-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000171
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 19 Region: 2052-2146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000034
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 20 Region: 416-532
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000262
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 21 Region: 3425-3485
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 22 Region: 2991-3108
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000127
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 23 Region: 511-602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000791
Family Spectrin repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000014488
Domain Number - Region: 3536-3636
Classification Level Classification E-value
Superfamily PH domain-like 0.01
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014488   Gene: ENSCAFG00000009849   Transcript: ENSCAFT00000015654
Sequence length 3658
Comment pep:novel chromosome:CanFam3.1:30:8878333:8922749:-1 gene:ENSCAFG00000009849 transcript:ENSCAFT00000015654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQPHTPQQLLGATGHLKQEASRRAPGQLSQARPTMDSAYEMSLVRKLQAQHTRMQEKT
FTNWINNIFWHGRVGIKIRNLYRELADGTHLLRLLELISGEALPPPSRGHMRAHFLENSS
RALAFLRGKVPIPFIGPENIVDGDQTLILGLIWVIILRFQISHISLDREEFGASAALLSA
KEALLVWCQRKTAGYANVNITDFSRSWSDGLAFSALIHAHRPDLLDYCSLHPKRPLHNLD
LAFHVAEQELGIAQLLDPEDVAALQPDERSIMTYVSLYYHHFSRLHQEQTVQRRLAKILL
QLQETEELQTQYEQLVADLLGWIAEKQVWLEARDFPDSLPATRQLLVAFAFFRTQEKPPR
LQQRGATEALLFRLQTALRAQNRKPFLPKEGLGPAELSQRWAGLEHAEASRSQALLQRLL
QLERLETLVRHFQRKAALRESFLTDTEHMLDQAAAAAPPASLAAVEAAAQRLGMLEASIP
PQEARFQALAEISDILQQEQHHDWADVACRQLEISGRWEQVLERLQGQKKQMADLQAVLS
LLQGVESTSNQLKELQVLASSTACGQQLAETVELLQKHDLLEAQVSAHGAHVHHLALQTA
ELDSSTGTSVEVLQAEVQALAQLHQSLVSLVRARRTLLEQTLQHAEFLDSCEEEEAWVRE
HERLVEGEALGRDLGTLRAALRKHKALEAEIRRHQAVCADLVRRGCDVGAPGLPTRPGPR
ERAEALQGAGQRLRARAASWGARLQAAALVQQVGAGGGEGGSILPWARRTRSEFSQDGLA
LLILPARSSWTAPFTLSSPPPSLLCPGEPPLDTLPSVLSAQVVSALSSLKRGRRTPGTWS
EVSCRPGPLGTEKMALSAELDPDFDPNTILQAQDCLRRDYEGLRVLAKHRRAHLEEAVAL
FGFYDLCGELQSWLENQTALLQMLQPQADDNVEVAQLKYENFLTALSVRRGYWAEVSSSA
EQLKQKYPEDTPKIQQQQEELSWRWGQLEALKIEKEMQLARTTDVCGFLYQCRSTQVQLQ
DLLLQLETLKLGQSEDSHRTLQLVQQKMLTLERSVHYLQGAAIKAKESSPTKSQSLQEQV
ETLQGLLERGQQHVAQQARVQAEAQARQSFLRESQQLLLWMEGVWAQLHSEEKVVDMASA
QQLLLEHSNLLEEIRLQQERLRQLEAWGQPISALDSPDSQEVAHALGLLSQQGQGLQAAW
EQRQQRLQEGLELQRFGHDVDGFTAACASREAFLELDNLGEDVGEAQRLLQQHKEFGRLL
SILGHRAEALQARGEKLALSQHLAAHKVLVQLQSIQTQWTRIQERSEQRRRQLLASLQLQ
KWKQDVAELVLWIEEKGRRAADEPSREPSKVLQQLRQHEAAERELLANLGHVEGLQQVGR
QLLSSRPQAQEDVQSSLQGLRNKWEAVKRKMAEHGDQLRQARQQAQLLGLLQDAKKKMEQ
LEGALQSAETGQDLGSSRGLQRQHCQLERESQALASKMAALVSQAHQGLTSQTVMEETQK
YLLRFESLQGHLAARRLQLQASVGLYQFYQLSNLELTWVAEHMPSASSAKCLSGAQSLRH
KHEELQVEVKAHQGQVQQVLGSGRSLAASGHPHAQCIVEQCEKLAGRWAELEQACEVQAQ
CLQEAVVLQQCFLAASELEDWVKAKQPLVSSQDCGGDQGATVRLIEKHQALRQELALHWS
SLEELDQRVQTLAGPETSEQLGMVRERLREQLQVLQELAAKRGCELEGTLKLHEFMGEAE
ELRCWLASQKQAARPEQSLGEDHEHILHLRSRFARFQHQVELGGQRVTTCQQLVESLLDL
GHSAAPNARQRQQDLQAAWSELWELTQAQGHLLQDAEVTLRVHRDLLEALKQVREKATSL
PSDVAPDLRGLEAQLRRHKELEHELVGTGWQLQELLETASTVQKLGPGPQAQAVQQRQQT
LMQAWEALKLHVEQRRTQLERACLLAHFHRAVQDYTSWAAAVRRELQGEESSQEPSGGLL
TLSAHQQLRAELEAREDLHQRAFQLGQQALLDVGTPMKEVQEWLQALQDEREQVFQAWER
QEEKLQTVHREQLFLRKCDHLEQILTAQEASLKAGALGSSVEEVEQLIRKHNTFQKVLTA
QDEKESALCEQAKTHGDPKVQERLHAVLEHRARVKELAEGRRRALHTSLLMTGFTRAVTQ
AQDWMEERVQQLKEPIPPGDLKDKLRLLRKHQAFEAEVQAHEGVITAVTKDGEALLAQSH
LRAGEVSQRLWELQECWRKLKQALALRRQDLEDGWNFLEFLRRADLADAWIQEMDAMVNV
GNLGRDLEHCLQLRRQLHQLRGVWAQDTVDDTHIRSINDLSLKLEKLDPEQVKTIRQRRH
ELNSRWKSFHGNLLWYRQQLEGALEMHILSRKLDELTERLREKAALVQALDLGKDLESVQ
RQIRKHKELEQDMGLLQAQVEPLEREVGRVCQQSPGAAKSLSPKQREMKDSWWQLWREAQ
KRRESLDALHRVQTLQAMLQHLLVWARKLRVEMDTRSAPGNPAEAQRRLEEHQELKAELD
SRADSISLARSTGQRLLAARLPSAAATRQALAALDQELNSLEGAWQLHQRQLQQDLELQL
VLSSVEQMESWLCSQEACPAGDGLGDSLANVETLLWKHKGLERDLEAQAEKISTLEAAAR
SLHQSGHPDAQGALGRCQAMLLRKEALVEGAGTRRRQLEELRQLQTLLQESFEVAMWLRE
KNSVALEEGWRDPALLQAQLWKQQSLQAELDANVHEQQRLQMEGQRLLQEGHPASETIQE
RLRELGELWDELQANSRRKAAALQEACKALRLRRSVEDLESWLEPVEVKLRDPIGDQAQP
ELDELMGAQGELEAAVDRQAGQAQLLLGQAQVITGEGRCLAQDVEDQARRLLQRLEDLRA
PLRERRAALEARRLALQFFRDADEELAWVQEKLPLATARDCGQSLISVRRLQEKHQNLER
ELSSHEALAQAVVDAGRRLVEAGAGRAVAARAQQLEDAVGCLRAEAAQRRRRLQQAQEAQ
QFLTELLEAESWLQQQGCALHTQDGAQSAEAARASLRRLEATRRLLEAFGPRLERLQQGA
ALLQGGQLPGSHSAQVLARLRAVGEAHSGLLRTAEGRARGWREQLQLHRAEREARLLETW
LAGKVAAAESQDHGQDLEAVEMLEKKFEAFRKEVQSLGPAKVEALRELAGSLERTAHKYN
PQIQAQRSRIEATWERLDRAIKARTQSLATAREVRGFEQTVAWLQSWMQEKATLMARDVC
GHSPSSVQTFEQQHRCLERELAAMEKEVARVRMEACRLGQLHPMAQDGLSEQLARVEEAW
ATLEVKAREQGQQLEQAARGHAFLGRCRELLTWAQEKQAVVSSEELAGDLVGAERLLAQH
DELGREIKEHCLQAQVVQQEGQQLIDSGHFMSLEVAGCLQELEGQLQALTEACVLRRERC
EENWGLQKLRQELDQAEAWLASREGLLLDPNCGHSVPDVELLLGRHQDLEKLLAAQEEKF
AQLQRKTGVEQKLLQPGTGLTPSNAGHGLTSLQQRPFGSWWPGVQLAETRDLQDAKGAFT
TEGFLELKQQLLLAGRQPCSSSGDGCHGTLGVSSLSLLWDKRTAAENMAPVATLDLREAQ
CERLGHQHSRKHTFSLKLSSEVETLRAAPSEGQAESRHHVLSRTAAQSLSLELRARPV
Download sequence
Identical sequences E2RGC7
ENSCAFP00000014488 ENSCAFP00000014488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]