SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014859 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014859
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-31
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 
Domain Number 2 Region: 201-280
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.84e-30
Family GAS2 domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014859   Gene: ENSCAFG00000010113   Transcript: ENSCAFT00000016067
Sequence length 313
Comment pep:novel chromosome:CanFam3.1:21:44279613:44404761:1 gene:ENSCAFG00000010113 transcript:ENSCAFT00000016067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEK
LDNGALLCQLAETVQEKFKEGMDANKPPKNLPLKKIPCKATAPSGSFFARDNTANFLSWC
RDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLS
APSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVERLSQGRYRVGEKILFI
RMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL
VVSANYKAKKEIK
Download sequence
Identical sequences F1PBV2
ENSCAFP00000014859 ENSCAFP00000014859 XP_005633815.1.84170 XP_534091.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]