SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000015262 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000015262
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-44
Family Calponin-homology domain, CH-domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000015262   Gene: ENSCAFG00000010378   Transcript: ENSCAFT00000016497
Sequence length 199
Comment pep:known chromosome:CanFam3.1:33:16637934:16653192:1 gene:ENSCAFG00000010378 transcript:ENSCAFT00000016497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIAHPPPGRAHFQQWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEIYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM
Download sequence
Identical sequences E2RE61
ENSCAFP00000015262 ENSCAFP00000015262 XP_535738.1.84170 9615.ENSCAFP00000015262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]