SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016032 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016032
Domain Number 1 Region: 16-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 510-631
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-32
Family Spectrin repeat 0.000000494
Further Details:      
 
Domain Number 4 Region: 391-505
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-24
Family Spectrin repeat 0.000000534
Further Details:      
 
Domain Number 5 Region: 635-746
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-22
Family Spectrin repeat 0.000000588
Further Details:      
 
Domain Number 6 Region: 739-867
Classification Level Classification E-value
Superfamily EF-hand 4.16e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016032   Gene: ENSCAFG00000010822   Transcript: ENSCAFT00000017321
Sequence length 894
Comment pep:novel chromosome:CanFam3.1:4:3348600:3415124:-1 gene:ENSCAFG00000010822 transcript:ENSCAFT00000017321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQIEPGVQYNYVYDDDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERVEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRAKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWEVLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences E2QUQ0
ENSCAFP00000016032 ENSCAFP00000016032 XP_002928642.1.58354 XP_856116.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]