SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016342 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016342
Domain Number 1 Region: 1303-1441
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 189-289
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000367
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016342   Gene: ENSCAFG00000011082   Transcript: ENSCAFT00000017652
Sequence length 1447
Comment pep:novel chromosome:CanFam3.1:7:2320582:2411266:-1 gene:ENSCAFG00000011082 transcript:ENSCAFT00000017652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENVPEELREPFYTDQYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQA
LAQKGLYVTDQEKLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSA
FFQATDLPYDIEDAVMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVP
ARYRKEQTLLKQLPCIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADS
LYNLQLIQEFCQEYLNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRV
VRPQGAEPVNDMPSIPVLNAAKTDILDSSCSSDFTASGEGAAFTQSHHHLPSRHSRPQAH
SSASVEGGIRRSSSMSYVDGFIGTWPKEKRSSVHGVSFDISFDKENTVHRSTPNRGITRS
ISNEGLTLNNNRVSKNTRKNLSFKPVNGEDEAESIEEELNIDSHSDLKSYMPLNTNELNS
NENIHYKLPNGALQNRVLLDEFGNQIETPSIEEALQIIHDTEKSPHTSQSDHIANGFFLH
NQEMSILNSNIKLNQSSPDTITDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRD
YTVSLDSDMDDASKFLQDYDMRTNNTREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAE
QKFRKLNHTDGKSSGSSSQKTTPEGSELNIPHVVAWGQIPEEAGLPQGRDTTQLLASEMV
HLRMKLEEKRRAIEAQKKKMEAAFTKQRQKMGRTAFLTVVKKRGDGISPLREEAAGAEDE
KVYTDRAKEKDSQKANGQRSKSLADLKESMETPQAKWLKSPTTPVDPEKQWNLASPSEET
LNEGEILEYTKSIEKLNSSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIR
DFKPSRQAGLSSAIASFSSDAPRPTHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLNRT
LTPPRSVDSLPRLRRFSPSQVPIQTRSFVCFGDDGEPQLKESKPKEEVKKEELESKGPTG
QYVHKPEEKEIKPLESTVSEVLSQPITETVCLTPNEDQLNQPTEPPPKPVIPPAAPKNVN
LIEVSLSDLKPPEKVDVSVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAAL
LEKRLRREKETQLRKQQLEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQL
KLMEDMDTVIKPRPQIAKQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESV
HSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNK
HIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEI
NKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPK
KLLPNKA
Download sequence
Identical sequences F1Q076
9615.ENSCAFP00000016342 ENSCAFP00000016342 ENSCAFP00000016342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]