SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016361 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016361
Domain Number 1 Region: 112-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.1e-44
Family G proteins 0.0000000294
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 8.77e-35
Family Transducin (alpha subunit), insertion domain 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016361   Gene: ENSCAFG00000011108   Transcript: ENSCAFT00000017672
Sequence length 292
Comment pep:novel chromosome:CanFam3.1:9:14932335:14967881:1 gene:ENSCAFG00000011108 transcript:ENSCAFT00000017672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTTYSNVIKGMRVLVDAREKLHIPWGDNSNQGNGDKMMAFDTRSPMAAQGMVETQVFLQY
LPIIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEADYIPSQQDILLARRPTKG
IHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRL
TESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKF
LVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
Download sequence
Identical sequences F1PZW8
ENSCAFP00000016361 ENSCAFP00000016361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]