SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017205 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000017205
Domain Number - Region: 31-101
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00276
Family Calponin-homology domain, CH-domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017205   Gene: ENSCAFG00000011702   Transcript: ENSCAFT00000018575
Sequence length 816
Comment pep:known chromosome:CanFam3.1:9:12308171:12342569:1 gene:ENSCAFG00000011702 transcript:ENSCAFT00000018575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSEAEWITIANNLLLKCHIHLRIRELEDCDANVFIALYQSILGEKVPDLIAIPRSQED
EAHNVQAVIDSLALDYLQVSLSHITGENIVKGDSESIKNLLEIFDGLLEYLTENISETSL
EKSETGQSFKESHLREPLEEPDSTKESKSSWKKVSFGRCSLSSEALGPSWDGDETESTGE
IIRLGDTAHTFSLRSNGADGPSEMQSKKALTMSREEMHPPSSSFLSKSRTSFTEDMEIPS
VDVIPSARKLGEPIRSAIPLHPPYHPSEPRAPCPIGKEYLRSSHISPAMNSTGESTAFSV
ESDNRVVLTSKSPEDSKQEICSAQIQGPRTRKLPKGKRYDSRPTVSSWDSTFSQRPGKRL
TEQELYAVSEKLSQRLSELDWMLKSALGDRIKEKTDYKEDDIGNEEMESGKDETLSQHSD
SIMECGSKKRRPGIPTRRTPPCRSHSLSPSPVNKNTQFHMEKKRQRKPKETDIRQFQAKA
ITEAFERELRRNKVQENIGSLGINEEKETEKIYREAVHKGTPKHSQPWKTYSRKTTTPSP
RGGLPKPNKAVPMKVNEHSLLPLMLEQFPFLYVSGQTLSKMWKEQITQIEQLRKDAYREN
RSKKKLQDEIEAALKRHDLLTALVKKEYEHNKRLQDFKDRIHKQKLTQSKIKENRQQIVR
ARKYYDDYRVQLRAKMMRMRTREEMIFKKLFEEGLQIQKQRLRDLRNYAKEKRAEQKRQH
QNELDSMENYYKDQFSLLAEAISQERQELKAREKSQAQTLYKVKRELRLKMEKEIQQLQH
MITQNDDDAFFRELEAERFRSRLHMASFQYSKNPFP
Download sequence
Identical sequences E2QWX9
XP_537590.3.84170 ENSCAFP00000017205 ENSCAFP00000017205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]