SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017397 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017397
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.44e-47
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017397   Gene: ENSCAFG00000011821   Transcript: ENSCAFT00000018777
Sequence length 199
Comment pep:known chromosome:CanFam3.1:38:22228242:22229661:1 gene:ENSCAFG00000011821 transcript:ENSCAFT00000018777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT
VLCELINGLYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK
NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGT
NRGASQAGMTGYGMPRQIL
Download sequence
Identical sequences A0A091CME3 F1P6P2 F1RJ93 G1Q288 H0XSI4
ENSMLUP00000017821 XP_003125720.2.46622 XP_003355153.1.46622 XP_003795250.1.62490 XP_003999651.1.62641 XP_004407911.1.74151 XP_004671160.1.11716 XP_005400236.1.28644 XP_005400237.1.28644 XP_005663269.1.46622 XP_006096341.1.53796 XP_006168905.1.99106 XP_008152483.1.99482 XP_010614989.1.5607 XP_012517361.1.63892 XP_013852337.1.46622 XP_014652541.1.5094 XP_016071088.1.3490 XP_020945242.1.46622 XP_020945244.1.46622 XP_852741.2.84170 ENSMLUP00000017821 ENSCAFP00000017397 ENSFCAP00000015109 ENSOGAP00000019076 ENSOGAP00000019076 ENSCAFP00000017397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]