SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018018 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018018
Domain Number 1 Region: 58-209
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-25
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 
Domain Number 2 Region: 244-319
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.57e-25
Family GAS2 domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018018   Gene: ENSCAFG00000012219   Transcript: ENSCAFT00000019422
Sequence length 718
Comment pep:known chromosome:CanFam3.1:26:22615255:22623292:1 gene:ENSCAFG00000012219 transcript:ENSCAFT00000019422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGDLQVVSGLVGTEHFLGPHRNPVSLPTHSDLAGPGMADPVAGIAGSAAKSVRPFRSSE
AYVEAMKEDLAEWLNALYGLGLPSGGDGFLTGLATGTTLCQHANAVTEAARALAAARPAR
GVAFQAHSVAPGSFMARDNVATFIGWCRTELGVPEVLMFETEDLVLRKNEKSVVLCLLEV
ARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPTVEEGTTETTTAAGAPSRGPRMTPS
DLRNLDELVREILGYCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDT
LEHYLDKHDPCRCSSSAHRPPQPRARTFSPQRVSPTPSPRAGSPAPGGERRSSRQEVTPI
SLRGSKEGTETPLRARDQLPPHPRSRRHSGDSDSSASSAQSGPLGVRSEDSGTGSRRERP
SRRLTTGTPASPRRPPAPRSQSRDRLDRGRPRGAPAGRGAQLSAPSPARRARSQSREEQA
VLLVRRDRDGQHSWVPRARVGGGSGRSSPQTPRARSPAAPRPLRVSSPSPELGTTPASVF
RTPLQLDPKQEQQLFRRLEEEFLANARALEAAAGGTPPGPASDPARAPDPPAPDSAYCSS
SSSSSSLSVLGGKGGQPGDSGRMANGLPGPRGPALSSSSDEGSPCPGVGGLPEAPGSPLA
GLELPRTWARGRMDTQPDRKPSRIPTPRGPRRPSGPTEPGSWHALHSVSPRAEPDSWM
Download sequence
Identical sequences F6UQ63
ENSCAFP00000018018 ENSCAFP00000018018 XP_543468.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]