SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018206 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018206
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-90
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 2212-2332
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-35
Family Pleckstrin-homology domain (PH domain) 0.00000182
Further Details:      
 
Domain Number 3 Region: 297-419
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-34
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 4 Region: 907-1062
Classification Level Classification E-value
Superfamily Spectrin repeat 2.03e-29
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 605-743
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-28
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 6 Region: 1855-2010
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1226-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-26
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 8 Region: 1644-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 8.14e-26
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 1014-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-25
Family Spectrin repeat 0.0000448
Further Details:      
 
Domain Number 10 Region: 532-640
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-22
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 11 Region: 741-855
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-20
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 12 Region: 1482-1594
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-20
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 13 Region: 1381-1493
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-20
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 14 Region: 429-527
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 15 Region: 2015-2076
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000202
Family Spectrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018206   Gene: ENSCAFG00000012306   Transcript: ENSCAFT00000019629
Sequence length 2390
Comment pep:novel chromosome:CanFam3.1:18:50638075:50672884:1 gene:ENSCAFG00000012306 transcript:ENSCAFT00000019629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDL
LYLMDWMEEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCDP
GKEYKPCDPQLVTERVASLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQ
QHLLASAETGRDLTGVLRLLNKHTALRGEMSGRQGPLKLTLEQGQQLVAEGHPGARQAAT
RMAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEF
STQALARQHRALEEEIRSHRPALDALRDQAVALPAALSRTPEVQGRVPSLERHYKELQAR
AGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPE
MNALAARITAVNDIAEQLLKASPPGKDSIVNTQKQLNHRWQQFRTLADGKKAALMSALSI
QNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTR
EANALATGHPAQASAINARLGEVQAGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAW
LGRTQTSVASEEGPATLPEAEALLAQHAALRGEVERARGEYSRLRALGEEVTRDQADPQC
LFLRQRLEALGIGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEM
PGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSEGNIHAEKIQEKADSIERRH
KKNQEAVQQLLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQ
AFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLEDLHKRWDRLESTTQAKARSLF
DANRAELFAQSCSALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEVE
AIQAQATALAQEDQGAGEVERTSRAVEEKFRALCQPMKERCQRLQASREQHQFHRDVEDE
ILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLTERQRAVGAAAAG
PELAELQEMWKHLSRELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDE
LSAQAEVKKHQVLEQALADYAQTIHQLAVSSQDMIDHNHPESTRISIRQAQVDKLYASLK
ELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFS
RDTSTIGQERVDGANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAA
HELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAFEHDIQALSAQVQQVQ
DDGHRLQKAYAGDKAEEIGRHMQAVAEAWTQLQGSSAARRQLLLDTTDKFRFFKAVRELM
LWMDGVNLQMDAQERPRDVSSADLVIKNHQGIKAEIEARADRFSSCIDMGQGLLARSHYA
AEEISEKLSQLQARRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAE
LGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEEQEQERKRKKEEEERRKQPPA
PEPTARRPEGDLVDSQTAPDATWDRTHPRPPAPTQQASVNGVCTDAESPQPLLEQQRLEQ
SSFPEGPGSGTGDEANGPRGEKQTRTRGPAPPVMPQSRSSESARVATLPPRGPELSAQEQ
MEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDSKAASMGVPYHGEVPVSLAR
AQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEP
AVPSATRGMTRAMTMPPVSPVGAEGPVVLRSKDGREREREKRFSFFKKSK
Download sequence
Identical sequences E2RSI4
ENSCAFP00000018206 ENSCAFP00000018206 9615.ENSCAFP00000018206 XP_005631479.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]