SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018519 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018519
Domain Number 1 Region: 173-403
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-88
Family Calponin-homology domain, CH-domain 0.0000202
Further Details:      
 
Domain Number 2 Region: 421-543
Classification Level Classification E-value
Superfamily Spectrin repeat 2.35e-32
Family Spectrin repeat 0.000000765
Further Details:      
 
Domain Number 3 Region: 657-778
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-32
Family Spectrin repeat 0.00000411
Further Details:      
 
Domain Number 4 Region: 538-653
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-24
Family Spectrin repeat 0.00000186
Further Details:      
 
Domain Number 5 Region: 886-1013
Classification Level Classification E-value
Superfamily EF-hand 6.41e-22
Family EF-hand modules in multidomain proteins 0.075
Further Details:      
 
Domain Number 6 Region: 782-893
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-20
Family Spectrin repeat 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018519   Gene: ENSCAFG00000012504   Transcript: ENSCAFT00000019966
Sequence length 1041
Comment pep:novel chromosome:CanFam3.1:18:50785811:50800845:-1 gene:ENSCAFG00000012504 transcript:ENSCAFT00000019966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIGLCFPPARRRQRVRRRPERQLVAVNSHYYYRHLRCTHEETERGRGFPMVTQHPRGGA
GTGTPNLRYGIHPGAPKSFSPLVSGQPLAWSLPKRPRPHPAPPTSPIFSANPIRGWAGRY
LTRPGCSGERGAERARSPSKMMMVMQPEGLGVGEGPFVGGSGGGEYMEQEEDWDRDLLLD
PAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMR
FHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSA
KEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLN
TAFEVAEKYLDIPRMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVL
AVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPP
RVQEKCQLEINFNTLQTKLRLSHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEI
RRLQRLQHLAEKFQQKASLHEAWTRGKEDMLSQRDYESASLQEVRALLRRHEAFESDLAA
HQDRVEHIAALAQELNELDYHEAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLET
IDQLQLEFARRAAPFNNWLDGAVEDLQDVWLVHSVEETQSLLTAHEQFKATLPEADRERG
AILGIQGEIQKICQTYGLRPSSTNPYINLTPQDINTKWDMVRKLVPSRDQTLQEELARQQ
LNERLRRQFAAQANAVGPWIQGKVEEVGRLATGMAGSLEEQMAGLRQQEQNIINYKSNID
RLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQE
QLNEFRASFNHFDRKRNGMMEPDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQA
FIDFMTRETAETDTAEQVVASFKILAGDKNYITPEELRRELPAEQAEYCIRRMAPYKGSG
APPGALDYVAFSSALYGESDL
Download sequence
Identical sequences E2RIM9
ENSCAFP00000018519 ENSCAFP00000018519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]