SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018733 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018733
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily L domain-like 1.19e-35
Family Ngr ectodomain-like 0.057
Further Details:      
 
Domain Number 2 Region: 564-678
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-28
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018733   Gene: ENSCAFG00000012735   Transcript: ENSCAFT00000020195
Sequence length 713
Comment pep:novel chromosome:CanFam3.1:33:28798306:28863637:-1 gene:ENSCAFG00000012735 transcript:ENSCAFT00000020195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLSRNRLSEIPIEACHFVSLENLNLYQNCIRYIPEAILNLQALTFLNISRNQLSTLPVH
LCNLPLKVLIASNNKLVSLPEEIGHLRHLTELDVSCNEIQTVPSQIGNLEALRDLNVRRN
HLVRLPEELAELPLIRLDFSCNKITTIPVCYRNLRHLQMITLDNNPLQSPPAQICIKGKI
HIFKYLNIQACKIAPDLPDYDRRPLGFGSCHEELYSGRPYGALDSGFNSVDSGDKRWSGN
EPTDEFSDLPLRVAEITKEQRLRRESQYQETRSSLVVTNGGGEHDLDQIDYIDSCTAEEE
EDEMRQPKGLEPDSLSSQFMAYIEQRRISHEGSPIKPVPLREFQKTEDMRRYSHQNRVPV
EPSSLMSLSPTHNQLSHTDVEFHRRREQLVERTRREAQLAALQYEEEKIRTKQIQRDAVL
DFVKQKASQSPQKQQPPLDGEPLQCPFPSRRSQHTDDSALLVSLSGLNQVGCAGTLPHSS
AFMPIKVSLAFNLILLFHADIVHHSPAYSFPAAIQRNQAQRPESFLFRAAVRAEANKGHA
SPLLSSSALTTDSADPITRPNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVV
LCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRNVENFLEACRKIGVPQDNLCSPSDILQ
LNLSVKRTVETLLSLGAHSEESSFVSLSLQLLGFVAFYCTLMLTLCLLYYWVF
Download sequence
Identical sequences F1PLT1
ENSCAFP00000018733 ENSCAFP00000018733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]