SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018867 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018867
Domain Number 1 Region: 970-1097,1129-1335
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-79
Family p120GAP domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 36-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-39
Family Calponin-homology domain, CH-domain 0.0000166
Further Details:      
 
Domain Number 3 Region: 1560-1657
Classification Level Classification E-value
Superfamily RGC domain-like 1.44e-32
Family RGC domain 0.00000189
Further Details:      
 
Domain Number 4 Region: 632-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000425
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018867   Gene: ENSCAFG00000012639   Transcript: ENSCAFT00000020334
Sequence length 1657
Comment pep:known chromosome:CanFam3.1:3:53681145:53791207:-1 gene:ENSCAFG00000012639 transcript:ENSCAFT00000020334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKIELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDHRIPADTFVAL
RNPNAMLVNLEEPLASTYQDVLYEAKQEKMTNAKNRTENSERERDVYEELLTQAEIQGNI
NKVNTSSALANVDLALEQGVAPALFRALQSPALGLRGLQQQNGDWYLKQLLSDRQHKRQG
GQADPLQKEELQSGVDAANITAQQYQRRLAAVAAINAAIQKGVAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQQQSPEHSLTHPELSVAVEMLSSVALINRALESGDMNTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKTQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLTEVAQHYQDTLIRAKREKAQETQDESAV
LWLDEIQGGIWQSNKDTQEAQKFALGIYAINEAVESGDVAKTLSALRSPDVGLYGVIPEC
GETYQSDLAEAKKKKLAAGDNNSKWVKHWVKGGYYYYHNLETQEGGWEEPSDFVQNSMQL
SREEIQSSISGVTAAYNREQLWLANEGLITRLQACCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLRAHKDEVVKIQSLTRMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMIVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMLNKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFKTALQEEIKSKVDQVQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDNSIRNMRA
VTDKFLSAIISSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLGIINEYLSQSYQ
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESAGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
SQFVKEDSNLTLQEKKDKIQSGLKKLTELGTVDPKNRYQELINDIAKDIRNQRRYRQRRK
AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFNRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences F1PJ65
ENSCAFP00000018867 XP_536199.2.84170 ENSCAFP00000018867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]