SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019079 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019079
Domain Number 1 Region: 814-933
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-35
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000019079
Domain Number - Region: 62-138
Classification Level Classification E-value
Superfamily CoA-transferase family III (CaiB/BaiF) 0.0811
Family CoA-transferase family III (CaiB/BaiF) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019079   Gene: ENSCAFG00000012922   Transcript: ENSCAFT00000020558
Sequence length 944
Comment pep:novel chromosome:CanFam3.1:26:24085016:24107726:1 gene:ENSCAFG00000012922 transcript:ENSCAFT00000020558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELQREEEALASKRFRAERQD
NKENWLHSQQQEAEQRAALARLAGRLESMNDVEELTALLRGAGEYEERKLIRAAIRRIRA
QEIEAATLAGRLCSGRPNGGSREESKGRAAHRLEQCEVPEQEKQEQHTEVPEPTPTPQGT
SRDVTTVTLLLRAPPGGTPSLPASPVSSPTTASPEPPLEPAEAQCPAAETVGSPEPPSSP
PRATSPEPQEPPATPSTERQVVSKLLPGPTEPPAVQGPTKDPSNTKRADLAGSRPCQRSL
SVLSPRQPAQNQEPPNPASGPSPFQRAGSVRDRVRKFTSDSPMAAGLQDGPPRLALGAST
PTRLLGPSHINTTPASSNGSSSRAPSDTSSRFSKEPRGTARPLAQLQSCPREEGPRGRGL
AARSLENRAGGPGARSEEPSAPLPVPAGTAEPGASMKTTFTIEIKDGRGQASTSRVLLPT
GNQRAELTLGLRAPPTLLSTSSGGKSTITHISSPATLAQLGSVTHVTSFSHASPGSRRGC
SIKAAEDAGTPVAHPPAFSTRRRSSAGPAHSSSLMEPEPAGPPSAAVEVANGAEQTQVDK
APERRSPLSTEELMAIEDESILDKMLDQTTDFEERKLIRAALRELRQKKRDQRDKERERR
LQEARARPGEGRGNTATETTTQHSQRAADGSAVSTVTKTERLVHSNDGTRTARTTTVESS
FVRRSENGGGSTMVQTKTFSSSSSKKMGSIFDREDEASPRPGSLAALEKRQAEKKKELMK
AQSLPKTSASQARKAMIEKLEKEGAAGSPGGPRAAVQRSTSFGVPNANSIKQMLLDWCRA
KTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHA
DCPQLLDTEDMVRLREPDWKCVYTYIQEFYRCLVQKGLVKTKKS
Download sequence
Identical sequences E2RES4
ENSCAFP00000019079 ENSCAFP00000019079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]