SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019405 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019405
Domain Number 1 Region: 94-191
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-29
Family Calponin-homology domain, CH-domain 0.00000255
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000152
Family Calponin-homology domain, CH-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019405   Gene: ENSCAFG00000013162   Transcript: ENSCAFT00000020900
Sequence length 234
Comment pep:novel chromosome:CanFam3.1:5:16390683:16392021:-1 gene:ENSCAFG00000013162 transcript:ENSCAFT00000020900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVMQCGSDVGRPDRGRLGFQVWLKNGV
VSGSLGRGAGALAPCWSGGVGPRVSAQLPVCPQILSKLVNSLYPDGSKPVKVPENPPSMV
FKQMEQVAQFLKAAEDYGVTKTDMFQTVDLYEGKDLAAVQRTLMALGSLAVTKNDGHYRG
DPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences E2RIF3
ENSCAFP00000019405 ENSCAFP00000033582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]