SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019828 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019828
Domain Number 1 Region: 964-1065
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-29
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019828   Gene: ENSCAFG00000013463   Transcript: ENSCAFT00000021355
Sequence length 1460
Comment pep:known chromosome:CanFam3.1:18:51614465:51630315:-1 gene:ENSCAFG00000013463 transcript:ENSCAFT00000021355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVWKRLQRVGKRAAKFQFVACYHELVVECTKKWQPDKLVVVWTRRNRRICSKAHSWQP
GIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYEAKEWTFVIENESKGQRKVLATAEVDL
AHYAGPVPARAPLRLRLKPKSVKVVQAELSLTLSGVLLREGRATDDDMQSLASLMSVKPS
DVGNLDDFAESDEEEANGPGAPETRSHVPQPDPSRELKTLCEEDEEGRVQSRQAAASPSS
AEDTSPTPVSAPAPPARASRGQGPEPATVAGGQVGLKAPRPLGTPPEERSSRQPRQDVAP
TPAPRFRKGSDAPWPPGPQGEDEASKASGAPLAGVGSSGEIQVQESPQEGTEAQGARLGP
GIEDEGSRDSLVGQKNKVEEGSPGDRPGARGVDTEHESEVTEVNTKRLDIRAGKAEESLE
VSQVDAEQRSKVRHVDTKGPEAIGVMSETRFKETPEAPPRGSQGRTGVRTGDEAPTILST
PAAEPVGHTRHLGDLKGDKAAAGHEREGTEVRGRVPGIGGTGPEQGPSVGAADVRPQVSR
YKGAPPAADQGVMSRDLEFWEAEAGDSRILGTETGVAESEVLGTQETEVGRSGFLEIEAG
TAKAEALEAQETESMGLGVLESEAAGMAESEELGTQKTEAGDSGFLETKTRMAETEILGT
QETAGGSGMLGTEAEAAESEIWGAQEAEVGGASMPEIEAGRAEAEILGTQETKVRGSGIK
YKMAGTQEAEIGGSEVPWFETRTAAAEILGTQEVAAGGAGVPRIENEVAGAQETEVADSR
VLRPEVGMAEMEGLWTQQTETTVLVTEKVKAETLGAQEAEPGLWETLKYEALQDSITKHG
VVVPQGVESEAETTVLRVQEVEAGVWGVSEARSGVLGAQEAEMEGLGPPKNELSILEPQD
AETGVSGTEKGKDAELNLPEASLTEAQVASRAGAGVRKPSGASSPEEPEEDGRLLGSQAP
PAQVSSSQSLLEWCQEVTAGYRGVRVTNFTTSWRNGLAFCAILHRFHPDKIDYASLDPLN
IKQNNKQAFDGFAALGVSRLLEPADMVLLSVPDKLIVMTYLCQIRAFCTGQELQLVQLEG
GGGAGTYCVASARPGPPDSLDTGGLAQRLREHRPEAPAEPKEPENRADRAAPEATSEDGG
AEPALEARSAEAPGDGPGARPSAPPAQGLVNGSGAPGAGGGARQRRPSVNGEAGPVPPPR
AHGSFSHVRDADLLRKRRSRLRNSNSFSAEDPDSGAAGASGATGAPAAEALSPDPSSVPG
PPTTAAPQQSPGKSLPSEEPPPSPGEEAGLQRFQDTSQYVCAELQALEQEQRQIDGRAAE
VETQLRRLMESGADKLQEEMLIQEWFTLVNKKNALIRRQDQLQLLIEEQDLERRFELLSR
ELRAMLAIEDWLKTAAQQHREQLLLEELVSLVNQRDELVRDLDHKERIALEEDERLERGL
EQRRRKLSRQLSRRERCSLS
Download sequence
Identical sequences F1P7S2
XP_005631533.1.84170 ENSCAFP00000019828 ENSCAFP00000019828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]