SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020373 from Canis familiaris 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020373
Domain Number 1 Region: 1011-1115
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-32
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020373   Gene: ENSCAFG00000013823   Transcript: ENSCAFT00000021938
Sequence length 1117
Comment pep:known chromosome:CanFam3.1:26:28025987:28125695:1 gene:ENSCAFG00000013823 transcript:ENSCAFT00000021938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKASRSVGSVPKVSGISKTQTVEKTKPENSSSASTGGKVIKTGTTASLSKTKSSDDLLA
GMAGGVTVTNGVKGKKSTCPSTGSSASAPAMTTVENKSKISTGTSSSTKRSTSIGNKESS
STRERLRERTRLNQSKKLPSAGQGANDVALAKRSRSRTTTECDVRMSKSKSDNQISDKAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGINEDHSEGDEKSEKEAIIAHQPTDVE
STLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEITP
GNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSD
DALDAPSSSESEGIPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQE
LADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVID
EDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKER
NHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSG
DKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDTIAKVEDEYRAFQEEAKK
QIEELNMTLEKLRSELEEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKK
LQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHE
AQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPT
VKTLIKSFDSASQVPNPTAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTA
LSDKRPNYGEIPVQEHLLRTSSTSRPASLPRVPAMESAKTISVSRRSSEEMKRDISAPEG
ASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNALLKW
CQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFTLAFQAAE
SVGIKSTLDINEMVRTERPDWQSVMLYVTAIYKYFET
Download sequence
Identical sequences Q2KNA0
ENSCAFP00000020373 ENSCAFP00000042779 NP_001041579.1.84170 XP_005636591.1.84170 XP_005636592.1.84170 XP_005636594.1.84170 XP_013963585.1.84170 ENSCAFP00000020373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]